BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_N04 (929 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80550.1 68414.m09443 pentatricopeptide (PPR) repeat-containi... 30 1.9 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 30 2.5 At2g32460.1 68415.m03965 myb family transcription factor (MYB101... 30 2.5 >At1g80550.1 68414.m09443 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 448 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 179 KFFEFEIRGXXLNKLISNPIQHPNH 253 K+FEFEI +N++I N PNH Sbjct: 93 KYFEFEISWALINRMIGNTESVPNH 117 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 692 PXPRGXGGXXYWGPXPXSSXXXTXLAPGPFXXXAXPXLXLPPXG 823 P P G GG Y+ P P S T P P PP G Sbjct: 95 PPPYGGGGQGYYYPPPYSGNYPTPPPPNPIVPYFPFYYHTPPPG 138 >At2g32460.1 68415.m03965 myb family transcription factor (MYB101) identical to putative transcription factor MYB101 GI:18087348 from [Arabidopsis thaliana] Length = 490 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +2 Query: 152 YFNEVSTDNKFFEFEIRGXXLNKLISNPIQHPNHEFEEIEINVLKNRINKKNI 310 Y N + DN F F + + SN + +PNH E I N NKK+I Sbjct: 220 YNNSLENDNNQFGFSV--PLSSSSSSNEVCNPNHILEYISENSDTRNTNKKDI 270 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,674,860 Number of Sequences: 28952 Number of extensions: 146282 Number of successful extensions: 276 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2217402144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -