BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_M24 (872 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0513 - 16681227-16683936,16685572-16685966 29 3.7 10_08_0956 + 21796707-21797497,21799603-21799861,21799969-21800142 29 4.9 08_02_0048 + 11606269-11606762,11623257-11623301,11623703-116237... 28 8.5 >04_03_0513 - 16681227-16683936,16685572-16685966 Length = 1034 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 266 QQGLLHKHESLRKFHDDVQGRIPSQEFGILDLL 364 Q G+LH+ ESL +D+ G IP QE LD L Sbjct: 905 QLGMLHQLESLDLSSNDLSGEIP-QELASLDFL 936 >10_08_0956 + 21796707-21797497,21799603-21799861,21799969-21800142 Length = 407 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/30 (33%), Positives = 11/30 (36%) Frame = +1 Query: 760 GLXAYYYYFHSPYRSXWXSGKXPSFQERRW 849 G YYYY Y W GK + W Sbjct: 165 GSGVYYYYMSGRYEGDWIDGKYDGYGVETW 194 >08_02_0048 + 11606269-11606762,11623257-11623301,11623703-11623772, 11623862-11623896,11624013-11624075,11624140-11624158 Length = 241 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Frame = -1 Query: 632 VKATIHHLNVVHFICNFHVDKILR----ISFVW 546 V T++ +++ F+C FHVD ++ ISF W Sbjct: 204 VMMTLNKASLIRFVCPFHVDLLIHDERAISFDW 236 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,495,290 Number of Sequences: 37544 Number of extensions: 341717 Number of successful extensions: 767 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2456227356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -