BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_M22 (918 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 25 3.2 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 25 4.2 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 25 4.2 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 25 4.2 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 25.0 bits (52), Expect = 3.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 283 ISEEQRKAARSLCG 324 ISEEQR+AAR L G Sbjct: 21 ISEEQREAARQLAG 34 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 24.6 bits (51), Expect = 4.2 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +1 Query: 169 ETQNQDVARSPAEVPNDPGKMF---VGGLSWQTSPGKSSKDISEEQRKAARSLCGHVTEP 339 +TQ++ A + EVP +P + F S ++PG SS ++ +R + + HV EP Sbjct: 90 QTQDEQRALNEGEVPPEPPRSFDCDSSTGSMASAPGTSSVPLTIHRR--SPGVPHHVPEP 147 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 24.6 bits (51), Expect = 4.2 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +1 Query: 169 ETQNQDVARSPAEVPNDPGKMF---VGGLSWQTSPGKSSKDISEEQRKAARSLCGHVTEP 339 +TQ++ A + EVP +P + F S ++PG SS ++ +R + + HV EP Sbjct: 90 QTQDEQRALNEGEVPPEPPRSFDCDSSTGSMASAPGTSSVPLTIHRR--SPGVPHHVPEP 147 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.6 bits (51), Expect = 4.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 105 RGGDGSRSRSAALPTTGHETQNLKEFP 25 RGG + ++ TT H T N+ + P Sbjct: 427 RGGSAIAATGSSTTTTNHVTNNIPDLP 453 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,157 Number of Sequences: 2352 Number of extensions: 9501 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99641691 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -