BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_M20 (861 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 1.2 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 24 2.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 8.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.6 bits (51), Expect = 1.2 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = -3 Query: 613 SCSKLNSRPDRAILSSPGVPPXGHQPL*YHTDSNISPH 500 +C P A P P H P YH SPH Sbjct: 298 ACHSPGVYPSTAGFLPPSYHPHQHHPSQYHPHRGSSPH 335 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 563 RAGQNGAVWSGIQFTTTILC 622 R +G+V G++FTTT+ C Sbjct: 142 RLSGDGSVTYGMRFTTTLAC 161 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +1 Query: 601 VYYNYTLSNNGVPTFSTDSY 660 +YY + ++ P + TDSY Sbjct: 114 LYYEFDVATKEPPPWETDSY 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,321 Number of Sequences: 438 Number of extensions: 4451 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -