BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_M17 (899 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 25 0.81 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 24 1.4 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 24 1.4 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 3.3 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 9.9 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 25.0 bits (52), Expect = 0.81 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -1 Query: 638 LVYIW---RAFPRFLRQLFVCRTR*CYEYNN 555 LVY++ F FLRQ+F CR C +Y N Sbjct: 157 LVYVYCCDNNFNVFLRQVFTCR---CKDYKN 184 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 24.2 bits (50), Expect = 1.4 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +2 Query: 530 FKKNDL-TFNYYIHNTTESYKRKVVEEI---EEMLAKYKLTDAY 649 FK+ L FNYY+ T YKR+ + E AK K T Y Sbjct: 70 FKEASLYCFNYYVIVVTTFYKRRTWTRLLKNLESCAKIKKTKRY 113 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 684 LKNAKEKDSAIWSTIRILYF 743 LKNA+ K++A+W +R ++ Sbjct: 130 LKNARVKNTALWKQLRYEHY 149 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.0 bits (47), Expect = 3.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 608 IEEMLAKYKLTDAYEELDKIIDLKH 682 IEE ++KYK + L K DL H Sbjct: 196 IEESISKYKHAELVMPLCKSCDLHH 220 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = +3 Query: 534 KKMTSPLIIIFITLPSPTNEKLSKKSRKCSPNIN 635 +++ + ++ + LPSP +++ S S + N+N Sbjct: 396 QQVEAAIVHLIANLPSPGSDQRSTPSPRVYGNVN 429 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,463 Number of Sequences: 336 Number of extensions: 4601 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25030786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -