BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_M06 (1307 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 25 1.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 2.2 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 6.6 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 25.0 bits (52), Expect = 1.2 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = +3 Query: 924 PTTXXPPXPKPXTTTXXPDXXPPRERXPPXXPPXXSQTPPNSR 1052 P+T PP P+ + P P ++ PP P +R Sbjct: 210 PSTIPPPPPEEDDDSNIPQNNPKNKQHNFNLPPGAIPVPDKNR 252 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.2 bits (50), Expect = 2.2 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +2 Query: 1100 DQGTKAPEXATXXSXPTSPXNXPTPXXXPPPT 1195 D G+ P A + P PTP P P+ Sbjct: 33 DTGSMTPNSAASPAPPEEEAASPTPGDVPTPS 64 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.6 bits (46), Expect = 6.6 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = +2 Query: 557 PPXASXRXTKTPEDPAANPPKXXRHXHGPGPTPTHATRKGXAPAPRSKTGXT 712 PP T TP +A HG GP T +PA + TG T Sbjct: 9 PPTPHESNTSTPVSKSAF---IELQQHGYGPLRTSYQHHFNSPAGNAHTGPT 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.135 0.458 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,519 Number of Sequences: 336 Number of extensions: 2499 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 59 effective length of database: 102,761 effective search space used: 38638136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -