BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_M05 (882 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1008 - 7987936-7988628,7988923-7989102 33 0.40 07_01_1201 - 11419851-11419913,11420090-11420311 29 4.9 >01_01_1008 - 7987936-7988628,7988923-7989102 Length = 290 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 723 RKXHASRREKGGQVSGKRQXRNRRAXEGAXQGETPG 616 R RR GG+V+G+ R+RR GA +GE G Sbjct: 239 RVRRRGRRGGGGEVNGEEAARSRRRRRGAWEGEEEG 274 >07_01_1201 - 11419851-11419913,11420090-11420311 Length = 94 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +3 Query: 540 LRPPDEHHKNRRSSQRWRN--PTGL*RYQAFPPGKLPXALSCSXPXAYRIP 686 L PP Q+WR+ PTG + +FP G LP A P R P Sbjct: 13 LLPPPPPLPALPQGQQWRSTGPTGKLCFCSFPAGALPPAAGAGQPAPDRQP 63 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,884,760 Number of Sequences: 37544 Number of extensions: 407253 Number of successful extensions: 937 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2491484208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -