BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_M05 (882 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07390.1 68418.m00846 respiratory burst oxidase protein A (Rb... 29 4.1 At3g55480.2 68416.m06162 adaptin family protein similar to AP-3 ... 29 5.4 At3g55480.1 68416.m06161 adaptin family protein similar to AP-3 ... 29 5.4 At1g68170.1 68414.m07787 nodulin MtN21 family protein similar to... 28 7.2 >At5g07390.1 68418.m00846 respiratory burst oxidase protein A (RbohA) / NADPH oxidase identical to respiratory burst oxidase protein A from Arabidopsis thaliana [gi:3242781] Length = 902 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 543 RPPDEHHKNRRSSQRW 590 RPPDEH NR S+ W Sbjct: 667 RPPDEHRLNRADSKHW 682 >At3g55480.2 68416.m06162 adaptin family protein similar to AP-3 complex beta3A subunit, Homo sapiens, SP|O00203; contains Pfam profile: PF01602 Adaptin N terminal region Length = 987 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 497 GLLLAFCSHVLSCVIPLILWITVLPPLSELIPL 399 GL L F S +LS IPL++ ITV +E++ L Sbjct: 924 GLRLRFSSKILSSEIPLLITITVEGKCTEVLNL 956 >At3g55480.1 68416.m06161 adaptin family protein similar to AP-3 complex beta3A subunit, Homo sapiens, SP|O00203; contains Pfam profile: PF01602 Adaptin N terminal region Length = 987 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 497 GLLLAFCSHVLSCVIPLILWITVLPPLSELIPL 399 GL L F S +LS IPL++ ITV +E++ L Sbjct: 924 GLRLRFSSKILSSEIPLLITITVEGKCTEVLNL 956 >At1g68170.1 68414.m07787 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 356 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -2 Query: 530 KRQQRGLFTVPGLLLAFCSHVLSCVIPLILWITVL 426 +R++R FT +LLA S +L VIP IL IT L Sbjct: 54 QRKKRPEFTCRLMLLALLSGLLGVVIPSILTITGL 88 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,909,724 Number of Sequences: 28952 Number of extensions: 297099 Number of successful extensions: 607 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2077687200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -