BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L22 (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 3.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.5 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 24 5.9 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 486 PPPPXXXXPPXPXXGG 439 PPPP PP P GG Sbjct: 586 PPPPPMGPPPSPLAGG 601 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.6 bits (51), Expect = 3.4 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +3 Query: 438 PPXXXGGGGXXXXXGGAPPXPPXRXXXXXXKKKKXL 545 PP GG GG PP P R K L Sbjct: 1300 PPNDGGGAAAAAAGGGYPPLMPQRRRRNSSNSKHDL 1335 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 441 PXXXGGGGXXXXXGGAPPXPPXRXXXXXXKKKKXL 545 P GGG GG PP P R K L Sbjct: 1304 PPNDGGGAATAAGGGYPPLMPQRRRRNSSNSKHDL 1338 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 502 GGXGGAPPXXXXXPPPP 452 GG +PP PPPP Sbjct: 742 GGPSSSPPVMESIPPPP 758 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 470,426 Number of Sequences: 2352 Number of extensions: 8038 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -