BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L21 (934 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37337| Best HMM Match : PGI (HMM E-Value=0) 29 5.4 SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 29 7.1 >SB_37337| Best HMM Match : PGI (HMM E-Value=0) Length = 391 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +3 Query: 393 RI*KFSVFL*QDEGMKLLLYSINSITLRTLKRSTRLPVLRVCISIKVNSCMP 548 R KFS FL +G L+ YS N +T T+K RL + I+++ S P Sbjct: 48 RFEKFSTFLDTSDGRLLVDYSKNIVTEETMKLLFRLDRAVLHIALRNRSNTP 99 >SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 1750 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 134 RATKPQAQEFKTRLSWFPKPRKQNLSKIL 48 + T Q F T +SW+PK R Q L K+L Sbjct: 1398 KTTLVQPFFFDTGISWYPKMRFQKLHKVL 1426 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,471,298 Number of Sequences: 59808 Number of extensions: 411784 Number of successful extensions: 943 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 888 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -