BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L21 (934 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39855-5|AAA81084.1| 118|Caenorhabditis elegans Hypothetical pr... 28 8.3 >U39855-5|AAA81084.1| 118|Caenorhabditis elegans Hypothetical protein F18G5.1 protein. Length = 118 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = -1 Query: 562 NSDVEGIQELTLIEMHTRKTGSLVERFKVLSVIELME*SNSFIPSSCHKKTENF 401 N+D+EG +E+ + + R+ +FK + + N + SS K+TENF Sbjct: 28 NNDIEGTKEVIYLYIQPRRISIYAPKFKYGPNRQYSDDENETL-SSDEKETENF 80 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,839,034 Number of Sequences: 27780 Number of extensions: 329530 Number of successful extensions: 728 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2402214122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -