BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L18 (877 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 0.92 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 3.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.5 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 25.0 bits (52), Expect = 0.92 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 746 IWEKIK-VNGRNGMPQSWLXIQWTSSY 823 +W + VNG P +WL + W S++ Sbjct: 147 VWRDARIVNGTRQPPNNWLSVFWGSAW 173 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.0 bits (47), Expect = 3.7 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 339 HYKLDQTNNIEVVISHHPLLPE-GGDR*KNSFCI 241 H L++TNNI +++ P+L E DR +N + Sbjct: 259 HSILNRTNNIFELVTVEPILTERPSDRQRNEILL 292 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 414 TSPRGVKIDGDDSSWDFGVSAGFYLDATNEP 506 T+P G +I+ + DFG A F + P Sbjct: 305 TAPLGAEIEPSTQTIDFGRPATFTCNVRGNP 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 255,128 Number of Sequences: 438 Number of extensions: 5831 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -