BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L17 (928 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 26 0.56 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.56 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.97 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 9.1 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 25.8 bits (54), Expect = 0.56 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 372 KNVLQAVQKTNDGHPFKWLLEGG 440 + +L+A +++N PF+WL G Sbjct: 210 RGILEAARRSNLSQPFQWLASDG 232 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 25.8 bits (54), Expect = 0.56 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 372 KNVLQAVQKTNDGHPFKWLLEGG 440 + +L+A +++N PF+WL G Sbjct: 300 RGILEAARRSNLSQPFQWLASDG 322 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.0 bits (52), Expect = 0.97 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 101 FLILTRYVKCQHARVST-LAMHHPRPPCLVRPTATAP 208 F++ + V+ +H L +HH PC++R + AP Sbjct: 1079 FVLHSLAVELEHGAAGLRLCLHHRDLPCVLRASTPAP 1115 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 192 GRTRHGGRGWCIA 154 G+TRH G CIA Sbjct: 820 GKTRHQNTGCCIA 832 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,273 Number of Sequences: 438 Number of extensions: 1614 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30234750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -