BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L16 (903 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF525673-1|AAM82611.1| 60|Anopheles gambiae cecropin CecB prot... 41 6e-05 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 23 9.6 >AF525673-1|AAM82611.1| 60|Anopheles gambiae cecropin CecB protein. Length = 60 Score = 40.7 bits (91), Expect = 6e-05 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 133 MNFAKILSFV-FALVLALRMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAK 309 MNF K+ V A+++ + + PRWK K++EK+GRN+ KA P V+ K Sbjct: 1 MNFTKLFILVAIAVLVVVGVQPVDGAPRWKFGKRLEKLGRNVFRAAKKALP---VIAGYK 57 Query: 310 AIG 318 A+G Sbjct: 58 ALG 60 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 23.4 bits (48), Expect = 9.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 312 SFSRTEDLDRRARFDDAITDVPAHFFNFLEDLP 214 S+ T D R+ R A+T +PA +++ + LP Sbjct: 283 SYFPTPDAARKHRQICAVTRLPARYYDPITQLP 315 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,689 Number of Sequences: 2352 Number of extensions: 10463 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -