BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L13 (875 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0269 + 16265191-16265472,16265574-16266149 31 1.2 05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 28 8.5 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -3 Query: 288 LPLFPLS*NRAWEPL---MESTDPQCHILQHRRPRLPL 184 LP P W PL M T P C +L++ RPRLPL Sbjct: 139 LPFAPSLVRGRWVPLVGEMARTGPLCLLLENPRPRLPL 176 >05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 Length = 66 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +2 Query: 254 HARFQLSGNSGRKHSRCCTSILRKFSGR------QHCVTVDCCC 367 + R +G+K RCC S R+ + R + C+ CCC Sbjct: 15 YPRLDSEQQAGKKKGRCCGSSCRRSTKRGETSFIEGCIAALCCC 58 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,433,229 Number of Sequences: 37544 Number of extensions: 266788 Number of successful extensions: 456 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -