BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L09 (934 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27D7.03c |mei2||RNA-binding protein involved in meiosis Mei2... 27 3.8 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 27 5.0 >SPAC27D7.03c |mei2||RNA-binding protein involved in meiosis Mei2|Schizosaccharomyces pombe|chr 1|||Manual Length = 750 Score = 27.1 bits (57), Expect = 3.8 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 401 MLKLNEKWTESQWAPESKRTKRSAHR*QITIGSSYQLHELXGPVP 535 ML N +W S ++ T +A IGSSY + G VP Sbjct: 388 MLNNNSEWNNSMTMSSNQETPTAASCAVSRIGSSYGMSNNFGSVP 432 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 26.6 bits (56), Expect = 5.0 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = -2 Query: 627 HFFXSRFRDIFXAEGTSTRSXHLQALEYGSPGTGPXNSCSW*LEPIVICHLCALL--FVR 454 HF F+ + G + S H LE+GS N S I IC +L F+ Sbjct: 442 HFLTGNFKCAYSYLGFAIHSAHTLGLEHGSTDNSTLNEVSTEETSIRICWSLRVLASFLY 501 Query: 453 LLSG 442 + SG Sbjct: 502 IQSG 505 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,656,827 Number of Sequences: 5004 Number of extensions: 47561 Number of successful extensions: 90 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 473333082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -