BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L09 (934 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33834| Best HMM Match : PAN (HMM E-Value=0.00029) 30 2.3 SB_27757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 >SB_33834| Best HMM Match : PAN (HMM E-Value=0.00029) Length = 198 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 551 LNTAVLAPVLLTRAAGNLN 495 LNTAVL+PV R+ GNLN Sbjct: 121 LNTAVLSPVYFRRSVGNLN 139 >SB_27757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 403 AKTQ*KMDRKSMGPRK*ANKEKRAQMTDYDRFKL 504 A+ Q K ++ + RK A ++KRA + D+DRFKL Sbjct: 288 AQVQDKWEQTAWA-RKLAMRKKRATLNDFDRFKL 320 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,610,159 Number of Sequences: 59808 Number of extensions: 379099 Number of successful extensions: 752 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -