BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L08 (929 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) 95 8e-20 At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA... 95 8e-20 At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) near... 29 5.8 >At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) Length = 105 Score = 94.7 bits (225), Expect = 8e-20 Identities = 47/101 (46%), Positives = 58/101 (57%), Gaps = 1/101 (0%) Frame = +3 Query: 99 MVXVPKQRRXYXXXXXXXXXXXXITVQKVQGKGTLP-RXRXRYDRKQQGYGGQSKPIFXX 275 MV +PK + Y Q +GK +L + + RYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 276 XXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 398 IVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA) similar to ribosomal protein L41 GB:AAA34366 from [Candida maltosa] Length = 105 Score = 94.7 bits (225), Expect = 8e-20 Identities = 47/101 (46%), Positives = 58/101 (57%), Gaps = 1/101 (0%) Frame = +3 Query: 99 MVXVPKQRRXYXXXXXXXXXXXXITVQKVQGKGTLP-RXRXRYDRKQQGYGGQSKPIFXX 275 MV +PK + Y Q +GK +L + + RYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 276 XXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 398 IVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) nearly identical to RelA/SpoT homolog RSH2 [Arabidopsis thaliana] GI:7141306; contains Pfam profiles PF01966: HD domain, PF04607: Region found in RelA / SpoT proteins Length = 709 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 391 LFLSPPSSKCLHLFNATCDLTLQSAHSRRST 299 L+ SPPSS C +CDL L S S S+ Sbjct: 9 LYASPPSSVCSTPHQISCDLDLTSRSSSTSS 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,062,773 Number of Sequences: 28952 Number of extensions: 132409 Number of successful extensions: 344 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2217402144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -