BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L01 (841 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 5.8 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 26 5.8 >SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 682 Score = 26.2 bits (55), Expect = 5.8 Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 154 SAPLXNRPYIVNPPKASNPXGNGSAPLDN---GASYVDRPQGRP 276 + P+ + + + A++P GN + P+DN SY+ Q P Sbjct: 270 NVPMGSTMFASSNQSAAHPDGNNALPMDNTHANISYMQSSQSMP 313 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 26.2 bits (55), Expect = 5.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 339 NFLRYSLLPTASTRERGRLEVRSALGTVHVRC 244 NF ++P STR+R + +R G +H+ C Sbjct: 756 NFRVLDIIPFTSTRKRMSVIIRDEDGIIHLIC 787 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,742,245 Number of Sequences: 5004 Number of extensions: 28961 Number of successful extensions: 55 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 414453330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -