BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_L01 (841 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 5.1 At1g72330.1 68414.m08367 alanine aminotransferase, putative simi... 28 6.7 At1g72110.1 68414.m08335 expressed protein 28 6.7 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +1 Query: 190 PPKASNPXGNGSAPLDNGASYVDRPQGRPYFKPTPFP 300 PP P S PLD Y PQG Y+ P+P P Sbjct: 141 PPPQHPPPRPQSQPLD----YYSAPQGNHYYSPSPPP 173 >At1g72330.1 68414.m08367 alanine aminotransferase, putative similar to alanine aminotransferase 2 SP|P34106 from Panicum miliaceum, SP|P52894 from Hordeum vulgare, GI:4730884 from Oryza sativa Length = 540 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 182 SLILPKPPTLMETAPHLSTTVHLTWTVPKADLTSSLPLSL 301 S + P+P L + P LS T + +D TSSLP++L Sbjct: 26 SFLSPQPRPLASSPPALSRFFSSTSEMSASDSTSSLPVTL 65 >At1g72110.1 68414.m08335 expressed protein Length = 479 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 388 NSYEILKYIVNTLFRY*-FSKIFFTSHREHQGK 293 N+ I++ I NTL + FS I T H EH+GK Sbjct: 41 NASTIVEGIKNTLINHPRFSSILVTGHGEHKGK 73 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,580,500 Number of Sequences: 28952 Number of extensions: 166376 Number of successful extensions: 371 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1941125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -