BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K22 (961 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.049 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 36 0.064 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 33 0.26 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 33 0.34 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.45 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 32 0.79 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 31 1.0 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.4 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 1.4 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 1.4 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.8 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 30 2.4 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 30 3.2 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 29 3.9 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 6.1 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 7.4 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = +3 Query: 117 PPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXXGPP 296 PPPP PPP P +G GP P G GWG P GPP Sbjct: 514 PPPPGAGQGWGQPPPGAGQGGGPPP--PGAGQGG-GPPPPGAGQGWGQPPPGAGQGGGPP 570 Query: 297 PXXGG-GXP 320 P G G P Sbjct: 571 PPGAGQGGP 579 Score = 35.9 bits (79), Expect = 0.049 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +3 Query: 183 PPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXXGPPP---XXGGGXP 320 PPP P +G GP P G GWG P GPPP GGG P Sbjct: 503 PPP--PGAGQGG-GPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPP 548 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = -2 Query: 666 GXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPP---XPXGPPFPXXXTXXGAP 505 G P P A +G P PPP G PPP GPP P G P Sbjct: 545 GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPP 601 Score = 32.3 bits (70), Expect = 0.60 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 6/71 (8%) Frame = +3 Query: 117 PPPPXXXXXXXXXXXXKXXXXAPPPXX------PXKXKGXXGPXXPXWGGGWGPPXXKXX 278 PPPP PPP P G GP P G G GPP Sbjct: 547 PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAG 606 Query: 279 XXXGPPPXXGG 311 G PP G Sbjct: 607 QGWGLPPPGSG 617 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -3 Query: 368 GGXXNXGGPXFXAKKKWX-PPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPPXP 213 G G P A + W PPP G G G P PP G PP P Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPP 592 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 666 GXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXP-----XGPPFPXXXTXXGAP 505 G P P A +G P PPP G PP P GPP P G P Sbjct: 501 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = -3 Query: 698 PPPPXXAXPGXAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPP 555 PPPP G P G +G + P G PP G PPP Sbjct: 536 PPPPGAGQGGGPPPPG--AGQGWGQPPPGAGQGGGPPPPGAGQGGPPP 581 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -3 Query: 698 PPPPXXAXPGXAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPPXP 549 PPPP G P G +G + P G PP G PP P Sbjct: 503 PPPPGAGQGGGPPPPGAG--QGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 550 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -2 Query: 666 GXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXP----XGPPFP 532 G P P A +G P PPP G PP P GPP P Sbjct: 534 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPP 582 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 234 PXWGGGWGPPXXKXXXXXGPPP---XXGGGXP 320 P G GWG P GPPP GGG P Sbjct: 484 PGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPP 515 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 222 GPXXPXWGGGWGPPXXKXXXXXG-PPPXXG-GGXP 320 GP P G G GPP G PPP G GG P Sbjct: 502 GPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGP 536 Score = 28.3 bits (60), Expect = 9.8 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +3 Query: 114 PPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXXGP 293 PPPP PPP G G P G GPP P Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGA-----GQGGGPPPPGAGQGGPPPPGAGQEGPP 590 Query: 294 PPXXG-GGXP 320 PP G GG P Sbjct: 591 PPGAGQGGGP 600 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.9 bits (79), Expect = 0.049 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +3 Query: 108 PPPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXX 287 PPPPPPP APPP P G P P GGG PP Sbjct: 660 PPPPPPPPPGGQAGG---------APPPPPPPLPGGAAPPPPPPIGGGAPPP-------- 702 Query: 288 GPPPXXGG 311 PPP GG Sbjct: 703 -PPPGFGG 709 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXG 234 PPP GG GGAP PPP G Sbjct: 680 PPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = -3 Query: 314 PPPXX--GGGPXXXXXFXXGGA--PXPPPXGXXRPPXP 213 PPP GG P GGA P PPP G PP P Sbjct: 666 PPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 698 PPPPXXAXPGXAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPP 555 PPPP G A P P G P PP GG PPP Sbjct: 664 PPPPPGGQAGGAPPPPPPPLPGGAAPPP-------PPPIGGGAPPPPP 704 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Frame = -3 Query: 314 PPPXXG--GG--PXXXXXFXXGGAPXPPPX--GXXRPPXPLXFXG 198 PPP G GG P G AP PPP G PP P F G Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 183 PPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXXGPPPXXGGGXP 320 PPP + G P P GG PP PPP GGG P Sbjct: 664 PPPPPGGQAGGAPPPPPPPLPGGAAPP---------PPPPIGGGAP 700 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.5 bits (78), Expect = 0.064 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 666 GXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPXGPPFPXXXTXXGAP 505 G P P P + SPPP G PPP P PP P AP Sbjct: 163 GPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAP 216 Score = 29.1 bits (62), Expect = 5.6 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +3 Query: 108 PPPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXX 287 P PPPPP + PPP P P GG PP Sbjct: 108 PTPPPPPRAPETPS-----QAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATG 162 Query: 288 GPPP 299 GPPP Sbjct: 163 GPPP 166 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +3 Query: 108 PPPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXX 287 PPPP P PPP G P P P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAA 186 Query: 288 GPPPXXGGGXP 320 PPP GG P Sbjct: 187 SPPPPSGGPPP 197 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/71 (32%), Positives = 23/71 (32%) Frame = +3 Query: 108 PPPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXX 287 PPPPPPP PPP G P P GG PP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPP------PGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 288 GPPPXXGGGXP 320 PPP GG P Sbjct: 974 PPPP--GGSAP 982 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 666 GXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPXGPPFP 532 G P G A P G PPP GG PPP P PP P Sbjct: 950 GNAPPPPPPPGGSAPPPG-GGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPX-PPPXGXXRPPXP 213 PPP GG G AP PPP G PP P Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPP 956 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +3 Query: 111 PPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXXG 290 PPPPP PPP G P P GG PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Query: 291 PP 296 PP Sbjct: 993 PP 994 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 698 PPPPXXAXPGXAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPP 555 PPPP PG + P P G P G PP G PPP Sbjct: 933 PPPP----PGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPPXP 213 PPP G P G P PPP G PP P Sbjct: 956 PPPPGGSAPPPGG----GAPPLPPPPGGSAPPPP 985 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = -2 Query: 672 GXGXPXGPXAXKGXX-AXVPXLWGXXXSPPPXGGXXXPPPXPXGPPFP 532 G P P G + P G PPP G PPP PP P Sbjct: 927 GGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLP 974 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPP 219 PPP G P P PPP G PP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPPXP 213 PPP GG G AP PPP P P Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +2 Query: 188 PXXXPKXXGXXGAXXXPLGGGXGPPXXKXXXXXGAPPXXGGGEXIFFLXXXGXXXXXXPP 367 P P G + P GG PP G+ P GGG G PP Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPPG---GSAPPPGGGAPPLPPPPGGSAPPPPPP 987 Query: 368 PXXPXP 385 P P P Sbjct: 988 PPPPPP 993 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 311 PPXXGGGPXXXXXFXXGGAPXPPPXGXXRPPXPLXFXG 198 PP GG P GG+ PPP PP P+ G Sbjct: 964 PPPGGGAPPLPP--PPGGSAPPPPPPPPPPPPPMRKLG 999 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPPXPL 210 PPP G P GG P PPP RPP L Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSL 389 Score = 31.5 bits (68), Expect = 1.0 Identities = 23/79 (29%), Positives = 24/79 (30%), Gaps = 8/79 (10%) Frame = +3 Query: 108 PPPP----PPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXX----PXWGGGWGPP 263 PPPP PPP APPP P + P P G PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 Query: 264 XXKXXXXXGPPPXXGGGXP 320 PPP GG P Sbjct: 357 PVGGAAPPPPPPPPVGGPP 375 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +3 Query: 111 PPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXXG 290 PPPPP + PPP G P GG PP G Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGA-APPPPPPPPVGG 373 Query: 291 PPP 299 PPP Sbjct: 374 PPP 376 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 315 SPPPIXGGAPXXXXFFXXGGPXPPP 241 +PPP+ G AP GGP PPP Sbjct: 354 APPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 698 PPPPXXAXPGXAXPX-GXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPPXP 549 PPPP + P G P P GG PP + PPP P Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -2 Query: 594 SPPPXGGXXXPPPXPX--GPPFPXXXTXXGAP 505 +PPP GG PPP P G P P G P Sbjct: 354 APPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP 385 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -3 Query: 698 PPPPXXAXPGXAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPPXP 549 PPPP G A P P +G P G PP G PPP P Sbjct: 287 PPPPPSR--GAAPPP---PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 365 GXXNXGGPXFXAKKKWXPPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPPXP 213 G GP W PPP GGP G P PPP G P P Sbjct: 192 GVGQHSGPYPGQPGMWGPPPM--GGPPPMGGPPGGYPPPPPPPGAGDPAYP 240 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = -2 Query: 672 GXGXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPXGPP--FPXXXTXXGA 508 G P G G P +WG PPP GG PP GPP +P GA Sbjct: 186 GGYPPAGVGQHSGPYPGQPGMWG----PPPMGG----PPPMGGPPGGYPPPPPPPGA 234 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 660 PXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPXGPP 538 P P G P G PPP G PPP GPP Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 618 PXLWGXXXSPPPXGGXXXPPPXPXGPPFPXXXT 520 P G PPP G PPP GPP P T Sbjct: 379 PPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPT 411 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 591 PPPXGGXXXPPPXPXGPPFPXXXTXXGAP 505 PPP G PPP GPP P T P Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPPXP 213 PPP GP G P PPP PP P Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 698 PPPPXXAXPGXAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPPXPXXP 540 PPPP P P P G P G PP G PPP P Sbjct: 365 PPPPP---PTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = -2 Query: 672 GXGXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPXGPPFPXXXTXXGAP 505 G G P + P PPP PPP GPP P T P Sbjct: 341 GGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Score = 28.3 bits (60), Expect = 9.8 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +3 Query: 108 PPPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXX 287 PP PPPP K PPP P GP P PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNK----PPPPPPPTN-----GPPPPPPPTNGPPPPPPPTNGP 404 Query: 288 GPPPXXGGGXP 320 PPP G P Sbjct: 405 PPPPPPTNGPP 415 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXGXXRPP 219 PPP G P GGAP PPP PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 672 GXGXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPXGPP 538 G G P P A P PPP GG PPP P PP Sbjct: 286 GGGAPVPPPPPADGSAPAPP------PPPPPGGAPPPPPPPPPPP 324 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = -2 Query: 402 PGXPXLGXGNXGGGXKXXXXPXXXKKKMXSPPPIXGGAPXXXXFFXXGGPXPPPXGXXXA 223 P P + G GG P PPP GGAP P PPP G A Sbjct: 278 PEVPDIVTG--GGAPVPPPPPADGSAPAPPPPPPPGGAPPPPP-----PPPPPPPGDGGA 330 Query: 222 PXXP 211 P P Sbjct: 331 PPPP 334 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 591 PPPXGGXXXPPPXPXGPPFP 532 PPP G PPP P PP P Sbjct: 306 PPPPPGGAPPPPPPPPPPPP 325 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 31.9 bits (69), Expect = 0.79 Identities = 21/73 (28%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = +3 Query: 108 PPPPPPPXXXXXXXXXXXXKXXXXAPP-PXXPXKXKGXXGP-XXPXWGGGWGPPXXKXXX 281 PPPPPPP P P P G GP P + G P + Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGP 1721 Query: 282 XXGPPPXXGGGXP 320 P P G G P Sbjct: 1722 MGPPGPSGGQGPP 1734 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +3 Query: 108 PPPPPPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXX 287 PPPPPP P P P KG G P G+ P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAI 88 Query: 288 GPPPXXG 308 GPP G Sbjct: 89 GPPGLPG 95 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = -2 Query: 672 GXGXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXP-PPXPXGPPFPXXXTXXGAP 505 G GP G V + G P P G P PP P GPP P P Sbjct: 769 GPNGQPGPPGINGPPGQVGEM-GPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = -2 Query: 672 GXGXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXP-PPXPXGPPFPXXXTXXGAP 505 G GP G + + G P P G P PP P GPP P P Sbjct: 599 GPNGQPGPPGVNGPPGEIGEI-GPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 654 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = -2 Query: 672 GXGXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXP-PPXPXGPPFPXXXTXXGAP 505 G GP G + + G P P G P PP P GPP P P Sbjct: 684 GPNGQPGPPGINGPPGQIGEM-GPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGP 739 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -2 Query: 672 GXGXPXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXP-PPXPXGPPFP 532 G GP G V + G P P G P PP P GPP P Sbjct: 854 GPNGQPGPPGINGPPGQVGEM-GPPGLPGPPGPASPPSPPGPPGPPGP 900 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/64 (28%), Positives = 21/64 (32%) Frame = -2 Query: 402 PGXPXLGXGNXGGGXKXXXXPXXXKKKMXSPPPIXGGAPXXXXFFXXGGPXPPPXGXXXA 223 P P G + G P K+ +PPP P F G P PP A Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 309 Query: 222 PXXP 211 P P Sbjct: 310 PPPP 313 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/64 (28%), Positives = 21/64 (32%) Frame = -2 Query: 402 PGXPXLGXGNXGGGXKXXXXPXXXKKKMXSPPPIXGGAPXXXXFFXXGGPXPPPXGXXXA 223 P P G + G P K+ +PPP P F G P PP A Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 221 Query: 222 PXXP 211 P P Sbjct: 222 PPPP 225 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -3 Query: 698 PPPPXXAXPG-XAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXPPPXPXXP 540 PPPP PG P P G GG + PP GG PPP P Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPP---GGYQQPPPGGYAP 206 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = +3 Query: 102 LXPPPP-PPPXXXXXXXXXXXXKXXXXAPPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXX 278 L PPPP PPP PPP P P P + PP Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPN 219 Query: 279 XXXGPPP 299 PPP Sbjct: 220 PPYPPPP 226 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/57 (28%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = -2 Query: 660 PXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPX--GPPFPXXXTXXGAPRTN 496 P P P L+ +PPP PPP P PP+P P N Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/63 (28%), Positives = 21/63 (33%) Frame = +3 Query: 183 PPPXXPXKXKGXXGPXXPXWGGGWGPPXXKXXXXXGPPPXXGGGXPFFFCXKXGXXXVXX 362 PPP P +G P P PP G PP P F + G + Sbjct: 284 PPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPPQQFDYQHGRANMDI 343 Query: 363 PPP 371 PPP Sbjct: 344 PPP 346 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 9/59 (15%) Frame = -3 Query: 698 PPPPXXAXPGXAXPXGXXPXKG-XXRXXPXFGG----XFXPPXXXGG----MXXPPPXP 549 PPPP P P G P G P GG PP GG M PPP P Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 695 PPPXXAXPGXAXPXGXXPXKGXXRXXPXFGGXFXPPXXXGGMXXP 561 PPP P P G P +G P G PP GGM P Sbjct: 217 PPPGMLPPPGGMPPGRMPPQGLPFPPP---GPIPPPPGAGGMRPP 258 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 617 PXFGGXFXPPXXXGGMXXPPPXP 549 P FGG PP GGM PPP P Sbjct: 647 PFFGG-IPPPPPGGGMFPPPPPP 668 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 225 PXXPXWGGGWGPPXXKXXXXXGPPPXXGGGXP 320 P P +GG PP PPP GGG P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVP 675 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 591 PPPXGGXXXPPPXPXGP 541 PPP GG PPP P P Sbjct: 654 PPPPGGGMFPPPPPPPP 670 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 591 PPPXGGXXXPPPXPXGPPFP 532 PPP PPP P PPFP Sbjct: 470 PPPPPPPPPPPPPPPPPPFP 489 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 606 GXXXSPPPXGGXXXPPPXPXGPPFPXXXTXXGAPR 502 G SPPP PPP P PP P + P+ Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQ 394 Score = 24.2 bits (50), Expect(2) = 3.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 95 LNPXXPPPPPP 127 ++P PPPPPP Sbjct: 363 MSPPPPPPPPP 373 Score = 23.8 bits (49), Expect(2) = 3.9 Identities = 16/66 (24%), Positives = 16/66 (24%) Frame = +2 Query: 101 PXXPPPPPPXXXXXXXXXXXXKXXKXXXPPXXXPKXXGXXGAXXXPLGGGXGPPXXKXXX 280 P PPPPPP PP P P PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Query: 281 XXGAPP 298 APP Sbjct: 436 LACAPP 441 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/79 (27%), Positives = 26/79 (32%), Gaps = 5/79 (6%) Frame = +3 Query: 99 ILXPPPPPPPXXXXXXXXXXXXKXXXXAPPP-XXPXKXKGXXG-PXXPXWGGGWGPPXXK 272 ++ PPPPPPP PPP P + G G P G G P + Sbjct: 681 MVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQ 740 Query: 273 ---XXXXXGPPPXXGGGXP 320 G P GG P Sbjct: 741 PPPPGQLPGQQPGQAGGRP 759 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = -2 Query: 660 PXGPXAXKGXXAXVPXLWGXXXSPPPXGGXXXPPPXPXGPPFPXXXTXXGAP 505 P GP + P + PPP G PP P G P P GAP Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPP-PMGTP-PSGHPPMGAP 2210 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 314 PPPXXGGGPXXXXXFXXGGAPXPPPXG 234 PPP GG P GG P PPP G Sbjct: 198 PPPGPGGIPPPPPPIR-GGVPPPPPMG 223 Score = 26.2 bits (55), Expect(2) = 6.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 225 PXXPXWGGGWGPPXXKXXXXXGPPPXXGGG 314 P P GG PP PPP GGG Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 Score = 21.0 bits (42), Expect(2) = 6.1 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 Query: 108 PPPPPP 125 PPPPPP Sbjct: 195 PPPPPP 200 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -2 Query: 591 PPPX--GGXXXPPPXPXGPPFPXXXTXXGAPR 502 PPP GG PPP P G P P G PR Sbjct: 202 PPPGFPGGAPPPPPPPFGAP-PPPALNGGPPR 232 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 591 PPPXGGXXXPPPXPXGPPFPXXXT 520 PPP PPP P PP P T Sbjct: 1165 PPPPSSPSPPPPPPPPPPPPTPTT 1188 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.150 0.522 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,300,288 Number of Sequences: 59808 Number of extensions: 352823 Number of successful extensions: 3386 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2235 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2824376637 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -