BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K20 (858 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061421-1|AAL28969.1| 300|Drosophila melanogaster LD35248p pro... 29 8.2 AF182826-1|AAF01031.1| 300|Drosophila melanogaster cyclophilin-... 29 8.2 AE013599-2502|AAF57839.1| 300|Drosophila melanogaster CG4886-PA... 29 8.2 >AY061421-1|AAL28969.1| 300|Drosophila melanogaster LD35248p protein. Length = 300 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 265 NDDGLFGKAGYNREIFNDDRGKLTGQAYGTRVLGPGGDSTN 387 N++G GK+ Y ++ FND+ L ++GT + G +TN Sbjct: 204 NNNGTGGKSIYGKK-FNDENFNLKHNSFGTLSMANSGANTN 243 >AF182826-1|AAF01031.1| 300|Drosophila melanogaster cyclophilin-33 protein. Length = 300 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 265 NDDGLFGKAGYNREIFNDDRGKLTGQAYGTRVLGPGGDSTN 387 N++G GK+ Y ++ FND+ L ++GT + G +TN Sbjct: 204 NNNGTGGKSIYGKK-FNDENFNLKHNSFGTLSMANSGANTN 243 >AE013599-2502|AAF57839.1| 300|Drosophila melanogaster CG4886-PA protein. Length = 300 Score = 29.1 bits (62), Expect = 8.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 265 NDDGLFGKAGYNREIFNDDRGKLTGQAYGTRVLGPGGDSTN 387 N++G GK+ Y ++ FND+ L ++GT + G +TN Sbjct: 204 NNNGTGGKSIYGKK-FNDENFNLKHNSFGTLSMANSGANTN 243 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,566,976 Number of Sequences: 53049 Number of extensions: 735507 Number of successful extensions: 1859 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1859 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4126982652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -