BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K14 (960 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0299 - 17051570-17052474,17053542-17053755 34 1e-05 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 35 0.041 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.34 07_01_0080 + 587674-588510 30 0.38 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 32 0.78 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 27 1.6 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 31 1.8 07_01_0753 - 5799733-5799741,5799938-5800642 31 1.8 05_01_0131 + 888247-888771,889092-889154 23 1.9 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 28 2.2 04_01_0354 - 4646826-4647314 30 2.4 09_01_0016 - 376742-376883,377973-378964 30 3.1 07_03_1643 + 28329090-28329125,28329260-28329335,28329413-28330305 30 3.1 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 3.1 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 4.2 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 4.2 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.2 10_08_0343 - 16960764-16960895,16961166-16961171,16961272-169616... 29 5.5 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 5.5 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 29 5.5 01_05_0490 + 22672241-22674679 24 6.1 12_02_1174 - 26696869-26698191 29 7.3 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 7.3 03_05_0067 - 20460206-20460703,20461255-20461530 29 7.3 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 7.3 09_02_0603 - 11150739-11150746,11150791-11151340 28 9.1 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 28 9.6 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 28 9.6 07_03_0560 + 19479597-19480667 28 9.6 07_03_0558 + 19461369-19462448 28 9.6 07_03_0177 - 14770777-14772045 28 9.6 06_03_1153 - 28047125-28047751 28 9.6 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 28 9.6 03_05_0630 + 26260159-26260272,26260520-26260894 28 9.6 02_04_0171 + 20581995-20582354,20582509-20583141,20584954-20585058 28 9.6 02_04_0170 + 20576149-20576889 28 9.6 01_01_0570 - 4231100-4232560 28 9.6 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 33.9 bits (74), Expect(2) = 1e-05 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 397 PXPXLPFXKXXFXXPPPXXXPPPPPXXFFFW 305 P P P + PPP PPPPP F W Sbjct: 306 PLPHFPPLPSFYPSPPPPPPPPPPPPPSFPW 336 Score = 33.5 bits (73), Expect(2) = 1e-05 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -3 Query: 700 FXXFPXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXX-FXGXXXXGXXXXXPPPPPPXX 524 F FP P PP P P PP P P F PPPPPP Sbjct: 239 FLPFPLPPI-PFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAF 297 Query: 523 XFFF 512 F F Sbjct: 298 PFPF 301 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = -3 Query: 757 PPPXFXXXXXXXXXXXXXFFXXFPXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXG 578 PPP F F P PPP P P P P P F Sbjct: 256 PPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPH---FPP 312 Query: 577 XXXXGXXXXXPPPPPP 530 PPPPPP Sbjct: 313 LPSFYPSPPPPPPPPP 328 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 397 PXPXLPFXKXXFXXPPPXXXPPPPP 323 P P PF PP PPPPP Sbjct: 271 PPPAFPFPHLPPIFSPPSPPPPPPP 295 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P P PPPPPP Sbjct: 652 PPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPP 694 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P K F PPP PPPPP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 547 PPPPPPPPSGNKPAFSPPPPPPPPPPP 573 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 4/47 (8%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXF----XGXXXXGXXXXXPPPPPP 530 PPP P P PP P P G PPPPPP Sbjct: 624 PPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPP 670 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P P PPPPPP Sbjct: 589 PPPPPLPNCLVPSPPPPPPPP------PILPNRSVPPPPPPPP 625 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P LP PPP PPP P Sbjct: 569 PPPPPPLPQSNYASSQPPPPPPPPPLP 595 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P P P PP P P G PPPPPP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPS-----GNKPAFSPPPPPPPPPP 572 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P P P PP P P G G PPPPPP Sbjct: 669 PPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGP---GVPSAPPPPPPP 718 Score = 27.9 bits (59), Expect(2) = 0.041 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 412 RXXPXPXPXLPFXKXXFXXPPPXXXPPPP 326 R P P P P PPP PPPP Sbjct: 615 RSVPPPPPPPPPLPNHSVLPPPPPPPPPP 643 Score = 27.1 bits (57), Expect(2) = 0.041 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -3 Query: 691 FPXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 F P PPP P PP P P PPPPPP Sbjct: 561 FSPPPPPPPPPPPPLPQSNYASSQPPPPPPP-------PPLPNCLVPSPPPPPP 607 Score = 25.0 bits (52), Expect(2) = 4.5 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPP 326 P P P + K PPP P PP Sbjct: 750 PPPPPLMTGKKAPAPPPPPPQAPKPP 775 Score = 22.6 bits (46), Expect(2) = 4.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 352 PPXXXPPPPP 323 PP PPPPP Sbjct: 774 PPGTVPPPPP 783 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P G PPPPPP Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P G PPPPP Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPP 368 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPX---PPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P G PPPPPP Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPP 340 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PP P P PP P P P PPPP Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/80 (25%), Positives = 20/80 (25%) Frame = -1 Query: 846 PPPPXXXXXXXXXXXXGGGXXXXXXXXXPPPPXXFXXXXXXPXXXXXFFXXXFPPXPXGX 667 PPPP PPPP P PP P G Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGP--SPPPPPPPGGK 373 Query: 666 XXXPPPXPXXXXXSXXPXXP 607 PPP P S P P Sbjct: 374 KGGPPPPPPKGGASRPPAAP 393 >07_01_0080 + 587674-588510 Length = 278 Score = 30.3 bits (65), Expect(2) = 0.38 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 412 RXXPXPXPXLPFXKXXFXXPPPXXXPPPPP 323 R P P P P PPP PPPPP Sbjct: 89 RRPPPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 412 RXXPXPXPXLPFXKXXFXXPPPXXXPPPPPXXFF 311 R P P P PPP PPPPP F Sbjct: 90 RPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPPLF 123 Score = 21.4 bits (43), Expect(2) = 0.38 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 Query: 565 GXXXXXPPPPPP 530 G PPPPPP Sbjct: 86 GMFRRPPPPPPP 97 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P P P P PPPPPP Sbjct: 1139 PPLPEGIGGVPPPPPVGGLGGPPAPPP--PAGFRGGTPPPNAHGGVAPPPPPP 1189 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/80 (23%), Positives = 19/80 (23%) Frame = -1 Query: 846 PPPPXXXXXXXXXXXXGGGXXXXXXXXXPPPPXXFXXXXXXPXXXXXFFXXXFPPXPXGX 667 PPPP PPPP P F PP G Sbjct: 1122 PPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGG 1181 Query: 666 XXXPPPXPXXXXXSXXPXXP 607 PPP P P P Sbjct: 1182 VAPPPPPPRGHGGVGGPPTP 1201 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P PPP PPPPP Sbjct: 74 PRPPSFAPENALPPSSPPPPSPPPPPP 100 Score = 22.6 bits (46), Expect(2) = 1.6 Identities = 10/36 (27%), Positives = 11/36 (30%) Frame = -3 Query: 625 PXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPPXXXF 518 P PP P + PPPPP F Sbjct: 44 PGPPSQPPPPQAMYQAHPQYPMPGSLPPPPPRPPSF 79 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPPXXF 314 P P P LP PPP PP PP F Sbjct: 48 PPPQPTLPPPPPRTLPPPPPPPPPQPPVGF 77 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPPXXFF 311 P P F + PPP PPPPP F Sbjct: 28 PPNQPYYAFPAAAYAPPPPPPPPPPPPTLVF 58 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 22.6 bits (46), Expect(3) = 1.9 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = -3 Query: 625 PXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P PP P P G PPPP Sbjct: 80 PPPPPPSTPTQFSVLRKVPTGPDPITSDPPPP 111 Score = 22.6 bits (46), Expect(3) = 1.9 Identities = 9/27 (33%), Positives = 10/27 (37%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P + P P PPPP Sbjct: 137 PPPLSEFPVLREVPSGPDPITSDPPPP 163 Score = 22.2 bits (45), Expect(3) = 1.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 134 PPPPPPLSEF 143 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 27.9 bits (59), Expect(2) = 2.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 412 RXXPXPXPXLPFXKXXFXXPPPXXXPPPPP 323 R P P P P PP PPPPP Sbjct: 118 RPPPPPPPHPPEDPPPHPPHPPDHPPPPPP 147 Score = 21.0 bits (42), Expect(2) = 2.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -3 Query: 547 PPPPPP 530 PPPPPP Sbjct: 84 PPPPPP 89 >04_01_0354 - 4646826-4647314 Length = 162 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 412 RXXPXPXPXLPFXKXXFXXPPPXXXPPPPP 323 R P P P P PPP PPPPP Sbjct: 76 RQFPNPRPH-PLPNLNLSPPPPPPPPPPPP 104 >09_01_0016 - 376742-376883,377973-378964 Length = 377 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 382 PFXKXXFXXPPPXXXPPPPP 323 P K F PPP PPPPP Sbjct: 51 PTKKAPFVAPPPPPPPPPPP 70 >07_03_1643 + 28329090-28329125,28329260-28329335,28329413-28330305 Length = 334 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPPXXFFF 308 P P P P + PP PPPPP + + Sbjct: 274 PTPMPPPPQMSYGYSPYPPMMMPPPPPPEYLY 305 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P P P PP P P PPPPPP Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPP 364 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = -3 Query: 688 PXXPXGXXXXPPPX-PXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P G PPP P P PP P P PPPPPP Sbjct: 258 PNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPP 311 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPP---PPPP 530 P G P P P P PP P P PP PPPP Sbjct: 67 PAGIAVHPSPPPPPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRPPPP 119 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 3/45 (6%) Frame = -3 Query: 658 PPPXPXXXXXX---PXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 PPP P P PP P P G PPPPP Sbjct: 113 PPPPPHLLHYYGHPPPPPPPPPPFKGDHYGGVYQNWQQNGPPPPP 157 >10_08_0343 - 16960764-16960895,16961166-16961171,16961272-16961640, 16962118-16962304,16962567-16962759,16962864-16963137, 16963215-16963374,16963985-16964199,16964784-16964876, 16965192-16965260,16965293-16965445,16965534-16965737, 16966416-16966691,16967336-16967431,16967585-16967788, 16967877-16968069,16968229-16968374,16968771-16969425, 16971462-16971774,16971989-16972139,16972602-16973815, 16973933-16974182,16974784-16975035 Length = 1934 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG +GR G G G Sbjct: 850 GGGGGRRGGGGGPNSQRGRGRGGGGAG 876 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/40 (30%), Positives = 13/40 (32%) Frame = -3 Query: 655 PPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPP 536 PP P P PP P P + PPPP Sbjct: 9 PPPPHSSYAAPPPPPPPPPGTSLYASYRHHAYPPHPPPPP 48 >03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 Length = 442 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG +GR G G G Sbjct: 31 GGGGGGGGGGGGGGGRGARGRRGEGWG 57 >01_05_0490 + 22672241-22674679 Length = 812 Score = 23.8 bits (49), Expect(2) = 6.1 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P PP PPPPP Sbjct: 642 PPPPPPTTRRSRKPPQPPSRPAPPPPP 668 Score = 23.4 bits (48), Expect(2) = 6.1 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 547 PPPPPPXXXFFF 512 PPPPPP F+ Sbjct: 609 PPPPPPPSSIFY 620 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 397 PXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P PPP PPPPP Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPPPPP 165 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = -3 Query: 688 PXXPXGXXXXPP---PXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PP P P P PP P P F G PPPPP Sbjct: 33 PQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQF--NFGPGPPQQQQPPPPP 86 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPP 536 P P PPP P P PP P F G PPPP Sbjct: 4 PPPPPQWAMGPPPPPQYFQAGPPPPPP-----QYFQGAHPPAAMWGQPPPP 49 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 373 KXXFXXPPPXXXPPPPP 323 K F PPP PPPPP Sbjct: 32 KGNFALPPPFGFPPPPP 48 Score = 24.6 bits (51), Expect(2) = 9.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P F F PP PPPPP Sbjct: 62 PPPPPLGSF----FVPPPQSRVPPPPP 84 Score = 22.2 bits (45), Expect(2) = 9.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 44 PPPPPPGSTF 53 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG + +G G G G Sbjct: 190 GGGGGGGQGGGAHARGYGQGGGGGGGG 216 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P P P PPPPPP Sbjct: 82 PPPPPPPPPPPPPPLSPTPTTTSWTTNSSSISASPILPPPPPP 124 >07_03_0560 + 19479597-19480667 Length = 356 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG F G G G G Sbjct: 135 GGGGGVGGGGGQGGGFGAGGGVGGGSG 161 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG F G G G G Sbjct: 211 GGGGGFGGGGGKGGGFGAGGGMGGGAG 237 >07_03_0558 + 19461369-19462448 Length = 359 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG F G G G G Sbjct: 140 GGGGGLGGGGGHGGGFGAGGGVGGGAG 166 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG F G G G G Sbjct: 212 GGGGGSGLGGGQGGGFGAGGGAGGGIG 238 >07_03_0177 - 14770777-14772045 Length = 422 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG F G G G G Sbjct: 102 GGGGGFGKGGGVGGGFGKGGGFGKGGG 128 >06_03_1153 - 28047125-28047751 Length = 208 Score = 28.3 bits (60), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 355 PPPXXXPPPPPXXFF 311 PPP PPPPP F+ Sbjct: 17 PPPLSPPPPPPPIFY 31 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = -3 Query: 655 PPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PP P P PP P G PPPPP Sbjct: 305 PPIPPPPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPP 346 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 306 QKKKXXGGGGGXXXGGGXXXXFFXKGRXGXGXG 404 Q ++ GGGGG GGG + GR G G G Sbjct: 85 QSRRSGGGGGGYGGGGGG----YGGGRGGGGYG 113 >02_04_0171 + 20581995-20582354,20582509-20583141,20584954-20585058 Length = 365 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + P P PPPPP Sbjct: 224 PTPRPVAPPQAGTWPLPAPAAMPPPPP 250 >02_04_0170 + 20576149-20576889 Length = 246 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + P P PPPPP Sbjct: 105 PTPRPVAPPQAGTWPLPAPAAMPPPPP 131 >01_01_0570 - 4231100-4232560 Length = 486 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG F G G G G Sbjct: 115 GGGGGGGVGGGVGAGFGSGGGVGAGGG 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.314 0.148 0.485 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,542,370 Number of Sequences: 37544 Number of extensions: 399005 Number of successful extensions: 6003 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4983 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2776393380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -