BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K14 (960 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 35 0.085 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 0.17 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.45 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 33 0.45 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 25 0.60 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.4 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 31 1.8 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 1.8 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 30 2.4 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 30 2.4 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.7 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 7.4 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 28 9.8 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 35.1 bits (77), Expect = 0.085 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 35.1 bits (77), Expect = 0.085 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 673 GXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 G PPP P P PP P P PPPPPP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP-PPPPAPPPPPPPPPPPPP 432 Score = 31.9 bits (69), Expect = 0.79 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP---PPPPPPPPPPPPPPPP 418 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPP 431 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 31.1 bits (67), Expect(2) = 0.17 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -3 Query: 655 PPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPPXXXFF 515 PP P P PP P P PPPPPP F+ Sbjct: 301 PPLPNFTSPSPPPPPPLPPAMPAMDDLLPP-EVLSPPPPPPPSEDFY 346 Score = 21.8 bits (44), Expect(2) = 0.17 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPP 326 P P P P P PPPP Sbjct: 353 PMPSPPEDLYDAPATLPSPIMPPPPP 378 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 93 PACPPACCAPPPPPP--PPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPP 143 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P PPPPPP Sbjct: 104 PPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P G PPP P P PP P P G PPPPPP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPP---------PPGDGGAPPPPPPP 337 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P G PP P P PP P P G PPPPPP Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPP----------GGAPPPPPPPPPP 323 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P PPPPPP Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PP P P P P G PPPPPP Sbjct: 153 PPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 25.4 bits (53), Expect(3) = 0.60 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P F PPP PPPP Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 22.2 bits (45), Expect(3) = 0.60 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 197 PPPPPPPPGF 206 Score = 21.4 bits (43), Expect(3) = 0.60 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 Query: 565 GXXXXXPPPPPP 530 G PPPPPP Sbjct: 193 GMPPPPPPPPPP 204 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P PPP P PP P P PPPPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P P P G PPPPPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP---GGSAPPPPPPPPPPPPP 994 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXX-PXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P PP P G PP PPP Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P G PPP P P PP P G PPPPP Sbjct: 915 PGGSVPPPPPPPGGNAPLPPPP----PGGSAPSQPPPPGGNAPPPPPPP 959 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P LP + PP PPPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPP 703 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 5/48 (10%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXF-----XGXXXXGXXXXXPPPPPP 530 PPP P P PP P P G PPPPPP Sbjct: 699 PPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P P P G PPPPPP Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAG---------LPPPPPP 759 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFX-GXXXXGXXXXXPPPPPP 530 PPP P P PP P G PPPPPP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P G PPP P P PP P G PPPPPP Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLG--------NPPPPPPP 398 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXX--FXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P G PPPPPP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P P G PPPPPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 673 GXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 G PPP P P PP P P F PPPPPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPF------------PPPPPP 494 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXP 599 P P G PPP P P PP P P Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = -3 Query: 691 FPXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 +P P PP P P PP P P PPPP P Sbjct: 140 YPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPP 536 PPP P P PP P P PPPP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 25.8 bits (54), Expect(2) = 3.7 Identities = 12/34 (35%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPP---XXXPPPPPXXFF 311 P P P PF + P PPPPP F+ Sbjct: 26 PPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFY 59 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 25 PPPPPPTRPF 34 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P G PPP P PP P P PPPPP Sbjct: 377 PGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPP 429 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P G PPP P P P + G PPPPPP Sbjct: 393 PGGILPGPPP-PGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPP 441 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P LP PPP PPPPP Sbjct: 906 PAPPPPLPLAPE----PPPPLPPPPPP 928 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P G PPPPPP Sbjct: 281 PPPPPLTGGMLP-PPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PP PP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 397 PXPXLPFXKXXFXXPPPXXXPPPPP 323 P LP PPP PPPPP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPP 694 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 324 GGGGGXXXGGGXXXXFFXKGRXGXGXG 404 GGGGG GGG F G G G G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFG 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.148 0.485 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,654,875 Number of Sequences: 59808 Number of extensions: 194405 Number of successful extensions: 1856 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1225 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2824376637 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -