BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K14 (960 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 35 0.19 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 35 0.19 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 35 0.19 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 35 0.19 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 33 0.58 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 33 0.58 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 33 0.58 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 28 1.8 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 28 1.8 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 31 2.4 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 31 2.4 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 31 2.4 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 31 2.4 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 31 2.4 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 31 2.4 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 31 2.4 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 31 2.4 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 31 2.4 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 31 3.1 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 31 3.1 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 31 3.1 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 31 3.1 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 31 3.1 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 31 3.1 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 31 3.1 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 31 3.1 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 30 4.1 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 30 4.1 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 30 5.4 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 30 5.4 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 29 7.2 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 29 7.2 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 29 7.2 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 29 7.2 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 29 7.2 AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p pro... 29 7.2 AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FB... 29 7.2 AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA ... 29 7.2 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 29 7.2 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 29 7.2 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 29 7.2 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 29 7.2 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 29 7.2 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 29 9.5 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 29 9.5 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPPXXFFFW 305 P P P P K PPP PPPPP +W Sbjct: 461 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPPGWW 493 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPPXXFFFW 305 P P P P K PPP PPPPP +W Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPPGWW 675 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPPXXFFFW 305 P P P P K PPP PPPPP +W Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPPGWW 675 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPPXXFFFW 305 P P P P K PPP PPPPP +W Sbjct: 643 PEPEPLSPVKKPAAAPPPPPPPPPPPPPPPGWW 675 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P P PPP P P PP P P PPPPP Sbjct: 151 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 202 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 140 PPPPAPPTLVPPPPPAPPTIKP-PPPPAPPTVEPPPPPPPAPPTVEPPPPPPP 191 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P P PPP P P PP P P PPPPP Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 403 PPPPAPPTLVPPPPPAPPTIKP-PPPPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P P PPP P P PP P P PPPPP Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P PP P P PPPPPP Sbjct: 403 PPPPAPPTLVPPPPPAPPTIKP-PPPPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 27.9 bits (59), Expect(2) = 1.8 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P P P G PP PPP Sbjct: 104 PPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 22.2 bits (45), Expect(2) = 1.8 Identities = 10/30 (33%), Positives = 10/30 (33%) Frame = -3 Query: 412 RXXPXPXPXLPFXKXXFXXPPPXXXPPPPP 323 R P P P P P P PP P Sbjct: 153 RPPPQPTPSAPAPSYGPPQPQPPAPQPPSP 182 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 27.9 bits (59), Expect(2) = 1.8 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P P P P G PP PPP Sbjct: 104 PPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 22.2 bits (45), Expect(2) = 1.8 Identities = 10/30 (33%), Positives = 10/30 (33%) Frame = -3 Query: 412 RXXPXPXPXLPFXKXXFXXPPPXXXPPPPP 323 R P P P P P P PP P Sbjct: 153 RPPPQPTPSAPAPSYGPPQPQPPAPQPPSP 182 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 309 KKKXXGGGGGXXXGGGXXXXFFXKGRXGXGXGXXR 413 K + GGGGG GGG F G G G G R Sbjct: 5 KPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGR 39 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPP 512 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 PPP P P PP P P G PPPPP Sbjct: 489 PPPPPLPAFVAPPPPPPPPPPPPPLANY---GAPPPPPPPPP 527 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPP 511 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = -3 Query: 691 FPXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXG---XXXXXPPPPPP 530 F P PPP P P PP P P PPPPPP Sbjct: 497 FVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 553 Score = 26.6 bits (56), Expect(2) = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 503 PPPPPPPPPPLANYGAPPPP--PPPPP 527 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 488 PPPPPPLPAF 497 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPP 607 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 PPP P P PP P P G PPPPP Sbjct: 584 PPPPPLPAFVAPPPPPPPPPPPPPMANY---GAPPPPPPPPP 622 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPP 606 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = -3 Query: 691 FPXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXG---XXXXXPPPPPP 530 F P PPP P P PP P P PPPPPP Sbjct: 592 FVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 648 Score = 27.1 bits (57), Expect(2) = 2.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 598 PPPPPPPPPPMANYGAPPPP--PPPPP 622 Score = 22.2 bits (45), Expect(2) = 2.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 583 PPPPPPLPAF 592 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPP 740 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 PPP P P PP P P G PPPPP Sbjct: 717 PPPPPLPAFVAPPPPPPPPPPPPPMANY---GAPPPPPPPPP 755 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPP 739 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = -3 Query: 691 FPXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXG---XXXXXPPPPPP 530 F P PPP P P PP P P PPPPPP Sbjct: 725 FVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 781 Score = 27.1 bits (57), Expect(2) = 2.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 731 PPPPPPPPPPMANYGAPPPP--PPPPP 755 Score = 22.2 bits (45), Expect(2) = 2.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 716 PPPPPPLPAF 725 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P PPP P PP P P G PPPPP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P P PPPPPP Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPP----PLANYGAPPPPPPPP 517 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPP 501 Score = 26.6 bits (56), Expect(2) = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 494 PPPPPPPPPPLANYGAPPPP--PPPPP 518 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 478 PPPPPPLHAF 487 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPPPP 512 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P PPP P PP P P G PPPPP Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 528 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P P PPPPPP Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPP----PLANYGAPPPPPPPP 527 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPP 511 Score = 26.6 bits (56), Expect(2) = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 504 PPPPPPPPPPLANYGAPPPP--PPPPP 528 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 488 PPPPPPLHAF 497 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P PPP P PP P P G PPPPP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P P PPPPPP Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPP----PLANYGAPPPPPPPP 517 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPP 501 Score = 26.6 bits (56), Expect(2) = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 494 PPPPPPPPPPLANYGAPPPP--PPPPP 518 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 478 PPPPPPLHAF 487 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPPPPPPP 660 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P PPP P PP P P G PPPPP Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 676 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P P PPPPPP Sbjct: 637 PPPPPLHAFVAPPPPPPPPPPPPP----PLANYGAPPPPPPPP 675 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPP 659 Score = 26.6 bits (56), Expect(2) = 3.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 652 PPPPPPPPPPLANYGAPPPP--PPPPP 676 Score = 22.2 bits (45), Expect(2) = 3.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 636 PPPPPPLHAF 645 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPPPPPPP 607 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 679 PXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPP 533 P PPP P PP P P G PPPPP Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 623 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P P PPPPPP Sbjct: 584 PPPPPLHAFVAPPPPPPPPPPPPP----PLANYGAPPPPPPPP 622 Score = 29.9 bits (64), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P PPP PPPPP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPP 606 Score = 26.6 bits (56), Expect(2) = 3.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 403 PXPXPXLPFXKXXFXXPPPXXXPPPPP 323 P P P P + PPP PPPPP Sbjct: 599 PPPPPPPPPPLANYGAPPPP--PPPPP 623 Score = 22.2 bits (45), Expect(2) = 3.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 547 PPPPPPXXXF 518 PPPPPP F Sbjct: 583 PPPPPPLHAF 592 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 477 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 430 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 480 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 573 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 623 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 572 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 622 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 477 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 477 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 477 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PPP P PP P P G PPPPPP Sbjct: 430 PAPPQMFNGAPPPPAMGGGPPPAPPAP--PAMGGGPPPAPGGPGAPPPPPPPP 480 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P PPPPPP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P P PP P PPPPPP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = -3 Query: 655 PPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PP P P PP P + PPPPPP Sbjct: 33 PPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPP 74 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = -3 Query: 655 PPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PP P P PP P + PPPPPP Sbjct: 33 PPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPP 74 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P P P G PPPPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-------PPMPGRAGGPPPPPPP 560 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P P P G PPPPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-------PPMPGRAGGPPPPPPP 560 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PP P PP P + G G PPPPP Sbjct: 343 PPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPP 395 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P PP P G PPPPPP Sbjct: 373 PPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PP P PP P + G G PPPPP Sbjct: 148 PPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPP 200 >AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p protein. Length = 463 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 625 PXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P P P G G PPPPPP Sbjct: 259 PYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPP 290 >AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FBgn0000810;fs(1)K10 protein. Length = 463 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 625 PXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P P P G G PPPPPP Sbjct: 259 PYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPP 290 >AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA protein. Length = 463 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -3 Query: 625 PXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P P P G G PPPPPP Sbjct: 259 PYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPP 290 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P PP P PP P + G G PPPPP Sbjct: 713 PPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPP 765 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P PP P G PPPPPP Sbjct: 373 PPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 658 PPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 PPP P PP P G PPPPPP Sbjct: 489 PPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P P P G PPPPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-------PPMPGRAGGPPPPPPP 560 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXPXXPXXXXFXGXXXXGXXXXXPPPPPP 530 P P G PPP P P P P G PPPPPP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-------PPMPGRAGGPPPPPPP 560 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 29.1 bits (62), Expect = 9.5 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 5/57 (8%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXP-----XXPXXXXFXGXXXXGXXXXXPPPPP 533 P P PPP P P PP P P G PPPPP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 29.1 bits (62), Expect = 9.5 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 5/57 (8%) Frame = -3 Query: 688 PXXPXGXXXXPPPXPXXXXXXPXPPXP-----XXPXXXXFXGXXXXGXXXXXPPPPP 533 P P PPP P P PP P P G PPPPP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.314 0.148 0.485 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,907,459 Number of Sequences: 53049 Number of extensions: 548204 Number of successful extensions: 5917 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 1646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4740 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4792133502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -