BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K09 (864 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.3 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 5.4 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.4 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 Query: 283 TGLHQGLEGRVRAPCCNSSTPSXRVSRGALGDANGKAK 396 T Q E +PC NS++P+ G NG K Sbjct: 917 TSPRQPAETHAGSPCRNSASPASSDRSGTPRSTNGDRK 954 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 22.2 bits (45), Expect = 5.4 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 7/39 (17%) Frame = +2 Query: 179 RRDAPXFFKDIEH-----HTXEFHKT--LXQXFNSLTKS 274 RR AP F+DI+H + E +T L + F SL KS Sbjct: 84 RRKAPQSFEDIQHQRVMANVRERQRTQSLNEAFASLRKS 122 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 89 GDANXDCNTEECV 51 G N DCN EC+ Sbjct: 541 GICNEDCNNPECL 553 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,407 Number of Sequences: 336 Number of extensions: 1474 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -