BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K09 (864 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55510.1 68416.m06164 expressed protein 32 0.57 At3g09250.1 68416.m01099 expressed protein 29 5.3 >At3g55510.1 68416.m06164 expressed protein Length = 594 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +2 Query: 527 QESQKLAKKVSSNVQETNEKLAPKIXGRLRRLREEHPGGDQEXPXXRQR 673 ++++K AKK +V++ + KL P I + + E H GD++ Q+ Sbjct: 6 KKARKFAKKNLQSVEKRSRKLKPFIKKKFAKRNERHQAGDKQEKKVEQQ 54 >At3g09250.1 68416.m01099 expressed protein Length = 244 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 506 ADVQNTVQESQKLAKKVSSNVQETNEKLAPKIXGRLRRLREEH 634 ADV++ + L + + + VQE N A KI +L+ L+E++ Sbjct: 78 ADVESISMDENTLKQDLETAVQEENYVEAAKIRDKLKELQEDN 120 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,763,322 Number of Sequences: 28952 Number of extensions: 143186 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -