BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K08 (865 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 30 2.8 SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 29.9 bits (64), Expect = 2.8 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 370 ALPSRCYRS*WCDRSYGNQLQCNWSK*STARYCRHW*TWSGNTRMKQPI-LSGKQ 209 ALP Y W S GN+ W S +Y + W SGN +KQ I LSG + Sbjct: 39 ALPGNKYIKQWIALS-GNKYIKQWIALSGNKYIKQWIALSGNKYIKQWIALSGNK 92 >SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 259 FTNVYNTGLLITLTNYIGAGSHSFDRTTSFDSIDLEELSEPT 384 F V +GLL+ +TN+ G G+ + ++ + SEPT Sbjct: 1491 FRTVKRSGLLLVITNHTGKGAVTLEQLEGQIVLSFTSESEPT 1532 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,277,520 Number of Sequences: 59808 Number of extensions: 384425 Number of successful extensions: 816 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -