BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K08 (865 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-7|AAK68560.1| 929|Caenorhabditis elegans Hypothetical ... 28 9.9 AC024759-4|AAK68434.1| 356|Caenorhabditis elegans Hypothetical ... 28 9.9 >AC084158-7|AAK68560.1| 929|Caenorhabditis elegans Hypothetical protein Y69A2AR.16 protein. Length = 929 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 328 FDRTTSFDSIDLEELSEPTTTLQPAQQSSXIAPPQWGRIRASDDD 462 F D++D E + PT + A S+ +APP+ R A D+D Sbjct: 221 FSSEEEADAVDNELVKWPTLMIVNAFVSNLLAPPKGTRPVAKDED 265 >AC024759-4|AAK68434.1| 356|Caenorhabditis elegans Hypothetical protein Y37E11AR.4 protein. Length = 356 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 602 DNDHHXSGLNVTWXGHCCXILLHHGVQYL 688 D+ H SGL TW GH ++ GV+++ Sbjct: 76 DDFHSESGLFATWLGHATVLVDLEGVKFV 104 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,509,792 Number of Sequences: 27780 Number of extensions: 280699 Number of successful extensions: 625 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2160943708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -