BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K07 (890 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 49 1e-06 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 46 1e-05 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 44 3e-05 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 44 3e-05 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 42 1e-04 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 40 4e-04 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 40 4e-04 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 40 6e-04 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 39 0.001 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 37 0.002 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 38 0.002 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 36 0.010 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 33 0.072 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 28 0.15 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 31 0.22 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 29 1.2 SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regula... 28 2.1 SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyc... 27 2.7 SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar... 27 2.7 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 27 2.7 SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 27 2.7 SPBC1347.05c |||DNAJ domain protein Scj1|Schizosaccharomyces pom... 27 3.6 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 27 3.6 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 27 3.6 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 27 4.7 SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe... 27 4.7 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 27 4.7 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 27 4.7 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 26 6.3 SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch... 26 6.3 SPBC800.09 |sum2||G2/M transition checkpoint protein Sum2|Schizo... 26 6.3 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 26 8.3 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 48.8 bits (111), Expect = 1e-06 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P P P P P PPPPPP PPPP PP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 48.8 bits (111), Expect = 1e-06 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPP P PPPPPP PPPP PPP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 41.5 bits (93), Expect = 2e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PPP P P P P P PP P PPPP PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 38.3 bits (85), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 9/52 (17%) Frame = -1 Query: 536 PPLXPPPX--PXPPPPXXPPXP-------PPPPPXXPXXXXPPPPXXPPPXP 408 PP PP P P P P P PPPPP P PP PPP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 36.7 bits (81), Expect = 0.004 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P P PPPPPP PP P PP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 33.9 bits (74), Expect = 0.031 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPP----XXPXPPPPPP 464 P P P P PPPP P PPPPPP Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 33.1 bits (72), Expect = 0.055 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXX----PXPPPPPPXXXPXPXPPXP 431 P P P P PPP P PPPPP P PP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 33.1 bits (72), Expect = 0.055 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP PP PP PP P P P P Sbjct: 761 PPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQAEPEP 803 Score = 32.7 bits (71), Expect = 0.072 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXP---PPPPPXXXP 452 P P PP P PPPP PPPPP P Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 31.5 bits (68), Expect = 0.17 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPPP PP PP R P P P Sbjct: 746 PAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP--PPPPPAVSAGGSRYYAPAPQAEPEP 803 Score = 25.8 bits (54), Expect = 8.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P P PP PPP PPPPP Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP---PPPPP 783 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 45.6 bits (103), Expect = 1e-05 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGGXG 543 G GGG G GG G GG GGG GG GG GG G G G GG G Sbjct: 225 GFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGPG 272 Score = 43.6 bits (98), Expect = 4e-05 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXG-GGXRGGXG 543 G G GGG G GG GGG GG GG GG G G GG GG G Sbjct: 222 GHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPG 266 Score = 36.7 bits (81), Expect = 0.004 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG----GGXGGXXGG-GGXGXG-GGXRGGXG 543 G GG GG G G G GG GG G GG GG G G GG GG G Sbjct: 188 GGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPG 238 Score = 35.9 bits (79), Expect = 0.008 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGG-GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GG GG GG GG G G GGG GG G Sbjct: 212 GFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPG-GFGGGL-GGFG 255 Score = 35.1 bits (77), Expect = 0.014 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GG G GG G GG G G GG G Sbjct: 184 GHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHG 224 Score = 32.3 bits (70), Expect = 0.095 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXG-GGGXGXXXXXXGGXXG 545 G G F GG GG G G G GG G G G GGG G GG G Sbjct: 208 GGFGGFGGEGHHHGGHGGFGGGPG-GFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGG 263 Score = 30.7 bits (66), Expect = 0.29 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 2/79 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKX-GXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGG-XGXG 455 G G GG G + G G G GG GG G G Sbjct: 189 GFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFG 248 Query: 456 XXXGGGGGGXGXXGGGGXG 512 GG GGG G GGG G Sbjct: 249 GGLGGFGGGPGGFGGGPGG 267 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 44.0 bits (99), Expect = 3e-05 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = -1 Query: 536 PPLXP----PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ P PP P P PP PPPP P PP PPP P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 41.1 bits (92), Expect = 2e-04 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PP--PPPXXPXXXXPPPP 429 P PP PPP PPPP PP P PP PPP P P P Sbjct: 1705 PTPP--PPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 39.9 bits (89), Expect = 5e-04 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P PPP PP P PP PPPP P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 37.9 bits (84), Expect = 0.002 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPP-XPPPPPPXXPXXXXPPP 432 P PP+ PP P PP P PP PPPP P P P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P PP PPPP P PP PP P P P P Sbjct: 1694 PQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 36.7 bits (81), Expect = 0.004 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXP 408 P P+ P P PP P PPPPP P PP P PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAP 1731 Score = 36.3 bits (80), Expect = 0.006 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P PPPP P PPPP P P P PPL + P Sbjct: 1705 PTPPPP--PMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 33.9 bits (74), Expect = 0.031 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPPPP P P P PP Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPP 1728 Score = 32.3 bits (70), Expect = 0.095 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P PP PPPP P P PP P P P Sbjct: 1700 PQMSAPTPPPPP-----MSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/38 (31%), Positives = 12/38 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P PP PPPP P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = -1 Query: 536 PPLXP--PPXPXPPPPXXPPXPPPPPPXXPXXXXP 438 PP+ P P P P P PPPP P P Sbjct: 1355 PPVRPAVPTSPKPQIPDSSNVHAPPPPVQPMNAMP 1389 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P P P P P P PPPP P Sbjct: 1356 PVRPAVPTSPKPQIPDSSNVHAPPPPVQP 1384 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXPXP 327 P P PP P PP P P P P S P P P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 44.0 bits (99), Expect = 3e-05 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 +G G GG GG G G G GGG GG GG GG G G RGG Sbjct: 8 RGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGG 59 Score = 43.2 bits (97), Expect = 5e-05 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GG GGG GG GGG G GG RGG G Sbjct: 10 GRGGSRGGRGGFN--GGRGGFGGGRGGARGGGRGGARGG-RGGRG 51 Score = 40.7 bits (91), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 G GG G GG GG GG GG G GG G GG GG G Sbjct: 20 GFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRG 65 Score = 39.1 bits (87), Expect = 8e-04 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGG-GGXGXXXXXXGGXXG 545 G +G RGG G GG G G GGG G GG GG G GG G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSG 62 Score = 39.1 bits (87), Expect = 8e-04 Identities = 23/53 (43%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG--GXRGG 537 +G G GG GG G G GG GG GG G G G GG G RGG Sbjct: 15 RGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARG-GRGGSSGGRGG 66 Score = 39.1 bits (87), Expect = 8e-04 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GG GG GG G GG +GG Sbjct: 30 GGRGGARGGGRGGARGGRGGRGGARGGR--GGSSGGRGGAKGG 70 Score = 38.3 bits (85), Expect = 0.001 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 RGG G GG G GG GGG G GGG G GG G G G Sbjct: 11 RGGSRGGRGGFNGGR--GGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAK 68 Query: 594 G 596 G Sbjct: 69 G 69 Score = 36.3 bits (80), Expect = 0.006 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GG GG GG G GGG G G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARG 45 Score = 35.5 bits (78), Expect = 0.010 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GG G G G G GG GGG GG GGG GG G Sbjct: 12 GGSRGGRG-GFNGGRGGFGGGRGGARGGGRGGARGGRGGRGG 52 Score = 30.7 bits (66), Expect = 0.29 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G GG GG G GGG G GG G G G G Sbjct: 6 GSRGGRGGSRGGR--GGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSG 62 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 41.9 bits (94), Expect = 1e-04 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPL P P P P PP P P P P PP P P P + P Sbjct: 107 PPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVPETNCHKESP 156 Score = 36.7 bits (81), Expect = 0.004 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPP-PXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P PP P P PP P P P P PP P P P +PL Sbjct: 102 PLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVPETNCHKESPL 157 Score = 34.7 bits (76), Expect = 0.018 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PL P P P PP P P P P PP P P P + P Sbjct: 92 PLLNELVPEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPP 140 Score = 29.1 bits (62), Expect = 0.89 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P P P P P P P PP P P Sbjct: 104 PREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 40.3 bits (90), Expect = 4e-04 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP PPP P P P P P P K P Sbjct: 151 PPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVP 202 Score = 40.3 bits (90), Expect = 4e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPP--PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PP P PPP P P PP P P P PP PPP Sbjct: 159 PIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPP 204 Score = 37.9 bits (84), Expect = 0.002 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P P P P PP P PP P PP Sbjct: 144 PPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPP 203 Score = 37.5 bits (83), Expect = 0.003 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP-XPXXXXKXP 387 PP PP P PP P P P P P PPP P K P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP 184 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PP PP P PPP PP P P PPP P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQP 177 Score = 35.5 bits (78), Expect = 0.010 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP P PP P PP P P PP P PP P P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRP-SIPPPSPASAPPIPSKAPPIP 168 Score = 33.5 bits (73), Expect = 0.041 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P PP P P PP P PP P PP P Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSP-ASAPPIPSKAPPIP 168 Score = 33.5 bits (73), Expect = 0.041 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P P PP P P PP P PPPP P Sbjct: 172 PPPAQPAAPVKSPPSAPSLPSAVPPMPPK--VPPPPLSQAP 210 Score = 32.7 bits (71), Expect = 0.072 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P PP PP P P PP P+ P PP P Sbjct: 168 PSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 32.3 bits (70), Expect = 0.095 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP--PPXXPPXPPPPPPXXPRXP--XPPXPXXPPP 415 P PP PP P P PPP P P P PP P PP Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPP 173 Score = 29.5 bits (63), Expect = 0.67 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP PP P P P P PP Sbjct: 140 PTSAPPRPSIPP----PSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Score = 29.5 bits (63), Expect = 0.67 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P P P PP P PP P P P P Sbjct: 140 PTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 487 PXPPPPPPXXXPXPXPPXP 431 P PPPPPP P P P Sbjct: 3 PAPPPPPPAPAPAAAAPAP 21 Score = 28.3 bits (60), Expect = 1.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP 474 P PPP P P P P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P P P P PP P P P P PP PL Sbjct: 152 PSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPL 206 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/43 (32%), Positives = 14/43 (32%), Gaps = 1/43 (2%) Frame = -2 Query: 577 PXXXPXXXXPX-PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P P P P P PP P PPPP P Sbjct: 168 PSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 25.8 bits (54), Expect = 8.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPP 436 PP PPP P P PP Sbjct: 5 PPPPPPAPAPAAAAPAPP 22 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 40.3 bits (90), Expect = 4e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G GG GG GG G G GGG RGG G Sbjct: 129 GARNGPAGRGGRG--GFRGGRGGSRGGFGGNSRGGFGGGSRGGFG 171 Score = 40.3 bits (90), Expect = 4e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GG GG GG G GG RGG Sbjct: 146 GRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 39.9 bits (89), Expect = 5e-04 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 +G G GG GG G G G GGG GG GG G GG RGG Sbjct: 137 RGGRGGFRGGRGGSRGGFGGNSRG--GFGGGSRGGFGGGSRGGSRGGFRGG 185 Score = 33.9 bits (74), Expect = 0.031 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGG 522 G GG GG G G GGG GG GG GG G G Sbjct: 153 GFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRG 192 Score = 29.1 bits (62), Expect = 0.89 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 +G G G G GG GG G GG G G G G Sbjct: 128 KGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGG 173 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 RGG GG G GG G GG G GG G Sbjct: 137 RGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRG 180 Score = 25.8 bits (54), Expect = 8.3 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G+ G RGG G G GG GG G GG G GG G Sbjct: 139 GRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGG--GSRGGSRGGFRGGSRGGFRG 192 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 39.5 bits (88), Expect = 6e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP PP PPPPP P PPPP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP--PP 30 Score = 39.5 bits (88), Expect = 6e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 PP PPP P PP P PPPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 36.3 bits (80), Expect = 0.006 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 PP PP PPPPP P P P P PP Sbjct: 5 PPGNPPPPPPPPGFEP--PSQPPPPPPP 30 Score = 35.5 bits (78), Expect = 0.010 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPPPP P P P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 33.9 bits (74), Expect = 0.031 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXP 430 PP PP PPPP P P PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 31.1 bits (67), Expect = 0.22 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PP PPPP P PP P P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPP----PPP 30 Score = 30.7 bits (66), Expect = 0.29 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPP 437 P PPP P P PP P P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP 469 P PP PP PP PPPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP PP P PPPPP Sbjct: 5 PPGNPPPPPPPPGF-------EPPSQPPPPPPP 30 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 38.7 bits (86), Expect = 0.001 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PPP PP P PP PP P P PP P K P Sbjct: 1189 PPV-PPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAP 1237 Score = 38.3 bits (85), Expect = 0.001 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPP---PPXXPPXPPPPPPXXPXXXXP-PPPXXPPPXP 408 P P PP P P PP PP PP P P PPP PP P Sbjct: 1172 PAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVP 1220 Score = 36.3 bits (80), Expect = 0.006 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP-PXP 408 PP+ P PP P PP P P PPP PP P P Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTP 1222 Score = 35.5 bits (78), Expect = 0.010 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP+ P PP P PP P P P P PP P + P S Sbjct: 1198 PPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVS 1250 Score = 34.3 bits (75), Expect = 0.024 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ P PP P PP PP P P PP P P Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPP 1218 Score = 33.9 bits (74), Expect = 0.031 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ P PP P PP P P P P PP P Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVP 1182 Score = 33.9 bits (74), Expect = 0.031 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ P PP P PP P PPP PP P Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVP 1201 Score = 33.5 bits (73), Expect = 0.041 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PP P PP P P P P PP P P Sbjct: 1074 PSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Score = 33.5 bits (73), Expect = 0.041 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP-PXP 408 PP+ P PP P PP P P P P PP P P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKP 1164 Score = 33.1 bits (72), Expect = 0.055 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXP----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + PP P P PP P PP P P P PP P P Sbjct: 1095 PKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAP 1150 Score = 32.7 bits (71), Expect = 0.072 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PP PP P PP P P P P PP+ Sbjct: 1088 PSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPV 1142 Score = 32.7 bits (71), Expect = 0.072 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPP---PPXXPPPXPXXXXKXP 387 P P + PP P P PP P PP P PP P PP P P Sbjct: 1143 PKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Score = 31.9 bits (69), Expect = 0.13 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PP P P PP P PP P PPP P Sbjct: 1025 PLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAP 1069 Score = 31.5 bits (68), Expect = 0.17 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPP--PPXXPPPXPXXXXKXP 387 P P PP P P PP P PP P PP P PP P P Sbjct: 1077 PAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAP 1131 Score = 31.1 bits (67), Expect = 0.22 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ P PP P PP P P P PP P P Sbjct: 1092 PPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPP 1141 Score = 30.7 bits (66), Expect = 0.29 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP PP P PP P P P P PP+ Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPV 1219 Score = 30.7 bits (66), Expect = 0.29 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP---PPXXPRXPXPPXP 430 P P PPP PP P P PP P PP P Sbjct: 1180 PVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVP 1220 Score = 30.3 bits (65), Expect = 0.38 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = -1 Query: 533 PLXPPPXPXP----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P P P P PP P P P PP P P Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVP 1112 Score = 30.3 bits (65), Expect = 0.38 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXPXXXXKXP 387 P P + PP P P PP P PP P P P PP P P Sbjct: 1105 PKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPP 1160 Score = 30.3 bits (65), Expect = 0.38 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXP 408 P P + PP P P PP P PP P P P PP P Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVP 1172 Score = 29.9 bits (64), Expect = 0.51 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP PP P PP P P P P PP+ Sbjct: 1007 PLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPV 1052 Score = 29.9 bits (64), Expect = 0.51 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PP P PP P PP P P Sbjct: 1027 PSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAP 1069 Score = 29.9 bits (64), Expect = 0.51 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPP--PPPPXXPXXXXP--PPPXXPPPXP 408 P P PP P PP P P PPP P P P P PP P Sbjct: 1035 PVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVP 1086 Score = 29.9 bits (64), Expect = 0.51 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPP---PPPXXPRXPXPPXP 430 P PP P PP PPP PP P PP P Sbjct: 1190 PVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Score = 29.5 bits (63), Expect = 0.67 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = -1 Query: 536 PPLXPPPXP----XPPPPXXPP--XPPPPPPXXPXXXXPPPP-XXPPPXPXXXXKXP 387 PP PPP P P PP PP P P P P PP P K P Sbjct: 966 PPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAP 1022 Score = 29.1 bits (62), Expect = 0.89 Identities = 24/97 (24%), Positives = 26/97 (26%), Gaps = 1/97 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXP-PPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXX 401 P P P PP P P P PP P P P P P PP+ Sbjct: 1117 PSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAP-PVPKPSVAAPPV-PAP 1174 Query: 400 XXNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXP 290 P P + P P PP P Sbjct: 1175 SSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVP 1211 Score = 29.1 bits (62), Expect = 0.89 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PPP P P P PP Sbjct: 1160 PVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPP 1213 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + P P P PP P PP P PP P P Sbjct: 1203 PSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 28.3 bits (60), Expect = 1.6 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXP-PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP-PXPXXXXKXP 387 P P P PP P PP P P P P PP P P P Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVP 1095 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPP-PPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP PP PP PP P P P P PP+ Sbjct: 1193 PPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPV 1239 Score = 27.9 bits (59), Expect = 2.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXP---PPPXXPPPXP 408 P P PP PPP P P PP PP P Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAP 995 Score = 27.5 bits (58), Expect = 2.7 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP------PXXPPPXPXXXXKXP 387 PP+ P PP P P PP P P P P P PPP P + P Sbjct: 1022 PPVPLPSADAPPIPV-PSTAPPVP--IPTSTPPVPKSSSGAPSAPPPVPAPSSEIP 1074 Score = 27.1 bits (57), Expect = 3.6 Identities = 22/96 (22%), Positives = 24/96 (25%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXX 398 P P P P P P P P P P P P P PP+ Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSG--APPVPAPSGIPPVPKPSV 1099 Query: 397 XNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXP 290 P P + P P PP P Sbjct: 1100 AAPP-VPKPSVAVPPVPAPSGAPPVPKPSVAAPPVP 1134 Score = 27.1 bits (57), Expect = 3.6 Identities = 21/96 (21%), Positives = 22/96 (22%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXX 398 P P P P P P PP P P P P PP+ Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPV--PAP 1117 Query: 397 XNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXP 290 P P P P PP P Sbjct: 1118 SGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVP 1153 Score = 27.1 bits (57), Expect = 3.6 Identities = 21/88 (23%), Positives = 24/88 (27%), Gaps = 1/88 (1%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXP-XPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPX 374 P P P PP P PP P P P P PP+ P P Sbjct: 1115 PAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPP-VPA 1173 Query: 373 XFFXLXPFXXXXSXXPXXXXXFFXPPXP 290 + P + P PP P Sbjct: 1174 PSSGIPPVPKPAAGVPPVPPPSEAPPVP 1201 Score = 26.6 bits (56), Expect = 4.7 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP-PPPXXPPPXPXXXXKXP 387 P P P PPP P P P P P P PP P P Sbjct: 1050 PPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAP 1102 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP------PPPPPXXPRXPXPPXPXXPPP 415 P P PPP PP P PP P + P P P P Sbjct: 1199 PVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 25.8 bits (54), Expect = 8.3 Identities = 16/61 (26%), Positives = 17/61 (27%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PPP P P P P PP Sbjct: 1027 PSADAPPIPVPSTAPPVPI--PTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPP 1084 Query: 415 L 413 + Sbjct: 1085 V 1085 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 36.7 bits (81), Expect = 0.004 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPP PP P P PPPP PPP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 32.7 bits (71), Expect = 0.072 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPP PP P P PP P PPP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 31.9 bits (69), Expect(2) = 0.002 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXP----PPPXXPPXPPPPPP 462 P P PP P P PP PPPPPP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 28.7 bits (61), Expect = 1.2 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P + P P P P PPPPP P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 28.7 bits (61), Expect = 1.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP P P P PP PP PP P P Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXP 430 P PP P P PP PPP PP P P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 27.9 bits (59), Expect = 2.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P PPPP P PP P P Sbjct: 225 PTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 27.1 bits (57), Expect = 3.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PP P P PPPP PPPP Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPP------PPPPP 197 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P PP P P PPPPPP Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPPPPPP 196 Score = 27.1 bits (57), Expect = 3.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 507 PPPPXXPPXPPPPP 466 PPPP P PP PP Sbjct: 273 PPPPATPSQPPRPP 286 Score = 27.1 bits (57), Expect = 3.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -1 Query: 506 PPPPXXPPXPPPPP 465 PPPP P PP PP Sbjct: 273 PPPPATPSQPPRPP 286 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P P PPPP PP Sbjct: 221 PEIPPTYTPKQADPLPAPPP----PPPPTLPP 248 Score = 25.8 bits (54), Expect = 8.3 Identities = 13/37 (35%), Positives = 13/37 (35%), Gaps = 1/37 (2%) Frame = -1 Query: 524 PPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P P P PP P P PP P Sbjct: 889 PVAVPAPIPAPVAEPAPPAAPAKEVVEKAPSPPATRP 925 Score = 25.0 bits (52), Expect(2) = 0.002 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P PPP P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPP 244 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 37.9 bits (84), Expect = 0.002 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPPPX-PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PPXPXXXXKXP 387 PP+ PP P PP PP PP P P PP P PP P P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAP 467 Score = 36.7 bits (81), Expect = 0.004 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPL P PP P P PP PP P PPP P P Sbjct: 447 PPLPPSAPIAPPLPAGMPAAPPLPPAAP---APPPAPAPAP 484 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-PXXPPPXPXXXXKXP 387 PP PP P PP P P PP P PP P P P P Sbjct: 424 PPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAP 474 Score = 35.1 bits (77), Expect = 0.014 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P PPP P PPP PP PP P Sbjct: 352 PLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIP 396 Score = 34.3 bits (75), Expect = 0.024 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPX--PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP PP PP P P P P PPP Sbjct: 251 PAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPP 295 Score = 34.3 bits (75), Expect = 0.024 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPP---PXXPPXPP-----PPPPXXPXXXXPPPPXXPPPXP 408 PP PP P P P PP PP PP P P PP P P P Sbjct: 428 PPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 Score = 33.9 bits (74), Expect = 0.031 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP-XXPXXXXPPPP 429 P PP P PP PPPPPP P PPP Sbjct: 340 PPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPP 378 Score = 33.5 bits (73), Expect = 0.041 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P PP P PP PPPPP P P PPL + P P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPP---PRSAPSTGRQPPPLSSSRAVSNPPAP 391 Score = 32.3 bits (70), Expect = 0.095 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP------XPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP P P PP PP P P PP PP P Sbjct: 388 PPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAP 436 Score = 31.9 bits (69), Expect = 0.13 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P P PP P PP P P PP PPP P+ Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAPV 488 Score = 31.1 bits (67), Expect = 0.22 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P P P P PPP PP PP P P Sbjct: 231 PIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRP 274 Score = 30.7 bits (66), Expect = 0.29 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPP-PPPXXPXXXXPPPPXXPPP 414 P PP P P PP P P PP PPP Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPP 259 Score = 30.3 bits (65), Expect = 0.38 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPP--XPXXPP 418 P PP P P P PP PP P P P P PP Sbjct: 425 PSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPP 468 Score = 30.3 bits (65), Expect = 0.38 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP PP P PP P P P PP P P Sbjct: 433 PSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAP-PPAPAPAP 484 Score = 30.3 bits (65), Expect = 0.38 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPP-----PPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP P P PP P P PPP P P P P Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPA--PAPAPAAP 487 Score = 29.9 bits (64), Expect = 0.51 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PPP P PP PPPP P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP 370 Score = 29.5 bits (63), Expect = 0.67 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPX--PXPPXPXXXPPLXXXXXXNXPFFP 377 P P PP P PP P P P PP PPL P P Sbjct: 418 PTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPP 471 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PP PP P P P P PPP Sbjct: 251 PAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPP 295 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP PP PPPP PPP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPP--PPP 343 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPP--PXXPXPPP-PPPXXXPXPXPPXPXXXPP 416 P PP P PP P P PP P P PP PP Sbjct: 433 PSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/57 (28%), Positives = 17/57 (29%), Gaps = 1/57 (1%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P PP PP P P PP P P PP P + P P Sbjct: 401 PALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAP 457 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPX-----PPPPPPXXXPXPXPPXPXXXPPL 413 P PP P PP P PP PP P P PPL Sbjct: 421 PSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPL 469 Score = 27.5 bits (58), Expect = 2.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 7/52 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP---PPXXPPXPPPPPPXXPR----XPXPPXPXXPPP 415 P P PP PP PPPPPP P PP PP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPP 362 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 7/43 (16%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-------PPXPPPPPPXXPXXXXPP 435 P PP P PPP PP PPP P PP Sbjct: 363 PPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPP 405 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%), Gaps = 1/30 (3%) Frame = -3 Query: 501 PPXXPPXPPP-PPPXXPRXPXPPXPXXPPP 415 PP P P PP P P P PPP Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPPP 259 Score = 25.8 bits (54), Expect = 8.3 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 13/62 (20%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPX----PPP---------PPPXXPRXPXPPXPXXPPPXXXXXXX 394 PP PPPP P PPP PP P P P PP Sbjct: 354 PPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTS 413 Query: 393 TP 388 TP Sbjct: 414 TP 415 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 35.5 bits (78), Expect = 0.010 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 430 GGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRG 534 GGG G GG G GG GG GG G G GG G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGGARSG 482 Score = 33.1 bits (72), Expect = 0.055 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG G GG G GG GGG G G GG G RG Sbjct: 448 GSRGGRGGFGGRGGFGGRGGFGGGRG--RGRGGARSGNPNRG 487 Score = 33.1 bits (72), Expect = 0.055 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGG 502 GG G GG G G GG GGG G GG Sbjct: 451 GGRGGFGGRGGFGGRGGFGGGRGRGRGG 478 Score = 28.3 bits (60), Expect = 1.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 472 GGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G GG G G G RGG G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFG 469 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 32.7 bits (71), Expect = 0.072 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP PPPP P PPPP P Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 255 Score = 32.7 bits (71), Expect = 0.072 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP PPPP P PPPP P Sbjct: 221 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 268 Score = 32.7 bits (71), Expect = 0.072 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP PPPP P PPPP P Sbjct: 234 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 281 Score = 32.7 bits (71), Expect = 0.072 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP PPPP P PPPP P Sbjct: 247 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 294 Score = 32.7 bits (71), Expect = 0.072 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP PPPP P PPPP P Sbjct: 260 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 307 Score = 32.7 bits (71), Expect = 0.072 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP PPPP P PPPP P Sbjct: 273 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 320 Score = 32.7 bits (71), Expect = 0.072 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP PPPP P PPPP P Sbjct: 286 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP 333 Score = 31.9 bits (69), Expect = 0.13 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPP 429 P PP+ P PPP PPPP P PPPP Sbjct: 299 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 5/45 (11%) Frame = -1 Query: 533 PLXPPPXPXPPPP-----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP PPPP P PPPP P Sbjct: 198 PAHHEPGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEP 242 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 28.3 bits (60), Expect = 1.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 498 PXXPPXPPPPPP 463 P PP PPPPPP Sbjct: 942 PAFPPPPPPPPP 953 Score = 28.3 bits (60), Expect(2) = 0.15 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 497 PXXPPXPPPPPP 462 P PP PPPPPP Sbjct: 942 PAFPPPPPPPPP 953 Score = 23.4 bits (48), Expect(2) = 1.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 485 PXPPPPPP 462 P PPPPPP Sbjct: 905 PTPPPPPP 912 Score = 23.0 bits (47), Expect(2) = 1.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 440 PPPPXXPPP 414 PPPP PPP Sbjct: 945 PPPPPPPPP 953 Score = 21.8 bits (44), Expect(2) = 0.15 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 Query: 536 PPLXPPPXPXPPPP 495 P + P P PPPP Sbjct: 899 PTIITHPTPPPPPP 912 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 31.1 bits (67), Expect = 0.22 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P P P P PP P P P PP P + P Sbjct: 659 PEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPPHDETQEP 711 Score = 29.9 bits (64), Expect = 0.51 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP----PPPPXXPXXXXPPPPXXPPPXP 408 P P+ P P PP P P P PP P P PP P Sbjct: 563 PAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAP 611 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP-PPXXPXXXXPPPPXXPPPXP 408 P P P P P P PP P P P P P P Sbjct: 575 PQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAP 614 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXP-----PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P P P PP P P P P P P P Sbjct: 590 PQPPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQP 637 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP----PPPPXXPXXXXPPPPXXPPPXP 408 P P+ P P PP P P P P P P PP P Sbjct: 593 PVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAP 641 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP-PPPPXXPXXXXPPPPXXPPPXP 408 P P P P P P P P PP P P PP P Sbjct: 641 PVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPPAVP 686 Score = 26.2 bits (55), Expect = 6.3 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXP--PPXPXPP-PPXXPPXPP-PPPPXXPXXXXPPPPXXPPPXP 408 P P+ P P P PP P P P P P P P PP P Sbjct: 623 PAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAP 671 Score = 25.8 bits (54), Expect = 8.3 Identities = 14/55 (25%), Positives = 14/55 (25%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P P P PP P P P P P P Sbjct: 560 PQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAP 614 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP---XPPPPPPXXPXXXXPPPP 429 P + P P PP P P PPPPP PP Sbjct: 721 PAIKPQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPP 759 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P + P PP P P P PPPP PP P Sbjct: 725 PQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 >SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regulator Prp45|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 27.9 bits (59), Expect = 2.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPP 468 P+ PP P PP PPPP Sbjct: 211 PMEPPKFRHKKVPRGPPSPPPP 232 >SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyces pombe|chr 1|||Manual Length = 354 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 430 GGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G G GG G G G GG G Sbjct: 214 GAAGIDPMSLMGGGLGGAGLGGLGGAGLGGFGGANNATAG 253 Score = 22.6 bits (46), Expect(2) = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGG 489 GGG G G G G G GG GG Sbjct: 225 GGGLGGAG---LGGLGGAGLGGFGG 246 Score = 21.8 bits (44), Expect(2) = 6.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGG 522 GG G G G G G G GG Sbjct: 277 GGAGFGAGLGDAGLGAGLGG 296 >SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 27.5 bits (58), Expect = 2.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 475 GGXGGXXGGGGXGXGGGXRGG 537 GG GG GG G GG RGG Sbjct: 508 GGRGGNYRRGGYGRGGFRRGG 528 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = -1 Query: 512 PXPP----PPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P P P P P PP PP Sbjct: 492 PLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPP 527 Score = 26.6 bits (56), Expect = 4.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPP--LXPPPXPXPP---PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PP P P PP P PP P P P Sbjct: 492 PLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVP-PGMALPPGMPAPFP 540 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ PP PP P P P P P P PP P Sbjct: 522 PPMVPPGMALPP---GMPAPFPGYPAVPAMPGIPGATAPPGAP 561 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXP 420 P L PPP P P P P P P P P P P Sbjct: 151 PVLRPPPVPQVPSHWYPVSLPSPNLPHQPISKPPVIPNLP 190 >SPBC1347.05c |||DNAJ domain protein Scj1|Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 437 GGXGXRGXXGGGGGGXGGXXGGGG 508 G G G GG GGG G GGG Sbjct: 72 GEEGLNGQPGGPGGGPGEGFPGGG 95 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXG 513 G GG GGG G GGG G Sbjct: 78 GQPGGPGGGPGEGFPGGGFG 97 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 27.1 bits (57), Expect = 3.6 Identities = 14/42 (33%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = -1 Query: 506 PPPPXXPPXPPPPPP-XXPXXXXPPPPXXPPPXPXXXXKXPF 384 P P PPPPPP P P P P P + F Sbjct: 347 PTPQVQGSRPPPPPPMPAPIYNVPNVPTVPTVSPNPFLQPTF 388 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 27.1 bits (57), Expect = 3.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 481 PPPPPPXXXPXPXPP 437 PPPPPP P PP Sbjct: 1882 PPPPPPMALPKAGPP 1896 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 26.6 bits (56), Expect = 4.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPP 464 P PP P PPP PP Sbjct: 802 PFKAPPPAPLPPPAPP 817 >SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 469 GGGGXGGXXG--GGGXGXGGGXRGGXG 543 GGG G G GG G GGG GG G Sbjct: 112 GGGHHGPLHGPHGGFGGRGGGRMGGRG 138 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PPPPP P P P P Sbjct: 407 PAYSTPARPTESPPPPPISSSSTTPRPDDKPSLPP 441 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P P P P P P P P PPPP P Sbjct: 105 PSQPPKEPALPSRGTPSLPSRPGSRPSVLNQEQVPPPPVRP 145 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 26.2 bits (55), Expect = 6.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 489 PPXPPPPPP 463 PP PPPPPP Sbjct: 306 PPPPPPPPP 314 Score = 26.2 bits (55), Expect = 6.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 488 PPXPPPPPP 462 PP PPPPPP Sbjct: 306 PPPPPPPPP 314 >SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 476 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 GG GGG G GG G GGG G Sbjct: 438 GGSFPGGGFPGGGFPGGSYNSQGFGMGGGFPG 469 Score = 25.8 bits (54), Expect = 8.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G G GGG GG G G GGG G Sbjct: 438 GGSFPGGGFPGGGFPGGSYNSQGFGMGGGFPG 469 >SPBC800.09 |sum2||G2/M transition checkpoint protein Sum2|Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP P P P P PP P P P Sbjct: 114 PPQPVQPNPYGAPYQQAPPAGAPYYMYPNAP 144 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 25.8 bits (54), Expect = 8.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPP 465 P P P PP PPPPP Sbjct: 1080 PSAPVANNVSKPSAVPPPPPPPP 1102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.310 0.155 0.525 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,190,578 Number of Sequences: 5004 Number of extensions: 29722 Number of successful extensions: 1582 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -