BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K07 (890 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 73 3e-13 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 65 8e-11 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 62 8e-10 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 59 5e-09 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 57 2e-08 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 56 3e-08 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 56 3e-08 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 56 3e-08 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 55 9e-08 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 55 9e-08 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 52 8e-07 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 51 1e-06 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 50 3e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 50 3e-06 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 49 6e-06 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 48 8e-06 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 48 1e-05 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 48 1e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 48 1e-05 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 48 1e-05 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 48 1e-05 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 48 1e-05 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 47 2e-05 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 46 3e-05 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 46 3e-05 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 46 3e-05 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 46 5e-05 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 46 5e-05 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 7e-05 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 45 7e-05 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 45 7e-05 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 45 1e-04 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 44 2e-04 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 44 2e-04 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 44 2e-04 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 43 3e-04 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 43 3e-04 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 43 3e-04 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 42 5e-04 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 42 5e-04 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 42 7e-04 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 42 7e-04 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 42 7e-04 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 42 7e-04 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 42 9e-04 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 41 0.002 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 40 0.002 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 40 0.002 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 40 0.003 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 40 0.003 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 40 0.003 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 40 0.003 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 40 0.003 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 40 0.003 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 40 0.004 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 40 0.004 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 39 0.005 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 39 0.005 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 39 0.005 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 39 0.005 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 39 0.005 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 39 0.005 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 39 0.006 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 39 0.006 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 38 0.008 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 38 0.008 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 38 0.008 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 38 0.008 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 38 0.008 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 38 0.008 SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) 38 0.011 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 38 0.011 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 38 0.011 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 38 0.014 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 38 0.014 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 38 0.014 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 38 0.014 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 37 0.019 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 37 0.019 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 37 0.019 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 37 0.019 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 37 0.025 SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 37 0.025 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 37 0.025 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 36 0.033 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 36 0.033 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 36 0.044 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.058 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 35 0.077 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 35 0.077 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 35 0.077 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.077 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 35 0.10 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_504| Best HMM Match : GRP (HMM E-Value=2.8) 35 0.10 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 35 0.10 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 35 0.10 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 34 0.13 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 34 0.13 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 29 0.17 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_15136| Best HMM Match : Peptidase_S13 (HMM E-Value=0.27) 34 0.18 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.21 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 33 0.23 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 33 0.23 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 33 0.23 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 33 0.23 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 33 0.23 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 33 0.31 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 33 0.31 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 33 0.31 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 33 0.31 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 33 0.31 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) 33 0.31 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.41 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 33 0.41 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 33 0.41 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_11360| Best HMM Match : PDZ (HMM E-Value=0) 33 0.41 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 33 0.41 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.51 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 32 0.54 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 32 0.54 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 32 0.54 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 27 0.57 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 0.62 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 32 0.72 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 32 0.72 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 32 0.72 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 32 0.72 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.72 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 31 0.95 SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) 31 0.95 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 31 0.95 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) 31 0.95 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 31 0.95 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 31 0.95 SB_41815| Best HMM Match : zf-CXXC (HMM E-Value=3.5e-17) 31 0.95 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 31 0.95 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 31 0.95 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 31 0.95 SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) 31 0.95 SB_23371| Best HMM Match : SRCR (HMM E-Value=0) 31 0.95 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 31 0.95 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 31 1.3 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 31 1.3 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 31 1.3 SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) 31 1.3 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 31 1.3 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 31 1.3 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 31 1.3 SB_52712| Best HMM Match : Dynein_light (HMM E-Value=3) 31 1.3 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 31 1.3 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.3 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 1.3 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.3 SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 31 1.3 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 31 1.7 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 31 1.7 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 31 1.7 SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) 31 1.7 SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.7 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 31 1.7 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 31 1.7 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 31 1.7 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 31 1.7 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 31 1.7 SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) 31 1.7 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 26 1.7 SB_5778| Best HMM Match : Gag_MA (HMM E-Value=1.2) 25 1.7 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 30 2.2 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 30 2.2 SB_45305| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 30 2.2 SB_1015| Best HMM Match : Extensin_2 (HMM E-Value=0.11) 30 2.2 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 30 2.2 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 30 2.2 SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) 30 2.2 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 30 2.2 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 30 2.2 SB_16709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 30 2.2 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 30 2.2 SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 29 2.3 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 30 2.9 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 30 2.9 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 30 2.9 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 2.9 SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 30 2.9 SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 30 2.9 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.9 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 30 2.9 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 30 2.9 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 29 3.8 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 29 3.8 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 29 3.8 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_13211| Best HMM Match : Extensin_2 (HMM E-Value=0.0053) 29 3.8 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 29 3.8 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 29 3.8 SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 29 3.8 SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_42247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 29 5.1 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_10487| Best HMM Match : FGF (HMM E-Value=1.4e-06) 29 5.1 SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) 29 5.1 SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 29 5.1 SB_26086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) 29 5.1 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 29 5.1 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 29 5.1 SB_59007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 29 6.7 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 29 6.7 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) 29 6.7 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) 29 6.7 SB_1944| Best HMM Match : DUF1482 (HMM E-Value=7.3) 29 6.7 SB_984| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 29 6.7 SB_45790| Best HMM Match : SERTA (HMM E-Value=2.8e-07) 29 6.7 SB_19238| Best HMM Match : DUF729 (HMM E-Value=1.4) 29 6.7 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 29 6.7 SB_18199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_16879| Best HMM Match : Stig1 (HMM E-Value=1) 29 6.7 SB_64| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 29 6.7 SB_45874| Best HMM Match : TIR (HMM E-Value=0.43) 23 7.2 SB_59310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) 28 8.8 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 28 8.8 SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_28631| Best HMM Match : Drf_FH1 (HMM E-Value=0.35) 28 8.8 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 28 8.8 SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) 28 8.8 SB_51494| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 28 8.8 SB_50230| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) 28 8.8 SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_26965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_1366| Best HMM Match : Collagen (HMM E-Value=6.2e-05) 28 8.8 SB_21796| Best HMM Match : COLFI (HMM E-Value=0) 24 9.1 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 72.9 bits (171), Expect = 3e-13 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PPPP PP PPPPPP P PPPP PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 72.5 bits (170), Expect = 4e-13 Identities = 28/52 (53%), Positives = 28/52 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P PPPP PP P PPPP P PPPP PPP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 72.5 bits (170), Expect = 4e-13 Identities = 28/52 (53%), Positives = 28/52 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P PPPP PP P PPPP P PPPP PPP P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 72.1 bits (169), Expect = 5e-13 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP PP PPPPPP P PP P PPP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 72.1 bits (169), Expect = 5e-13 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P PPPP PP PPPPPP P PPPP PPP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 71.7 bits (168), Expect = 7e-13 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P PPP P PP PPPPPP P PPPP PPP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 71.3 bits (167), Expect = 1e-12 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P PPPP PP PPPPP P P PPPP PPP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 71.3 bits (167), Expect = 1e-12 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P PPP P PP PPPPPP P PPPP PPP P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 71.3 bits (167), Expect = 1e-12 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP PP PPPPPP P PPPP PPP P Sbjct: 390 PPPPQPPPPPPPPPPP--PPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 69.3 bits (162), Expect = 4e-12 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP P PPPP PP PP PPP P PPPP PPP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 69.3 bits (162), Expect = 4e-12 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP PPPP PP PPPPPP P PPPP P P P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 64.5 bits (150), Expect = 1e-10 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -1 Query: 530 LXPPPXP--XPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 + PPP P PPPP PP PPPPPP P PPPP PPP P P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPP P PPPPPP P P PP P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPPP PP PPPPPP P P PP P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 63.3 bits (147), Expect = 3e-10 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPPP PP PPPPPP P P PP P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 62.9 bits (146), Expect = 3e-10 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPPP P PPPPPP P P PP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 60.5 bits (140), Expect = 2e-09 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPP P PPPPPP P P PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 60.5 bits (140), Expect = 2e-09 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPP P PPPPPP P PP P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPP P PPPPPP P P PP P PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP--PPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 58.8 bits (136), Expect = 5e-09 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PPPP P PPPPPP P P PP P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Query: 415 L 413 L Sbjct: 434 L 434 Score = 57.2 bits (132), Expect = 2e-08 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PPPP P PPPPPP P P P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P PPPP PP PPPPPP P P P P PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 52.8 bits (121), Expect = 4e-07 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PP PPP P P PP PP PPPPPP PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 52.0 bits (119), Expect = 6e-07 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P PP PPP P PP P PP PPPPPP PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 51.6 bits (118), Expect = 8e-07 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP PPP P PPP PP PPPPPP PP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP PPPP P PPPPPP P P PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 64.9 bits (151), Expect = 8e-11 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGGGG GG GGGG G GGG GG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 62.1 bits (144), Expect = 6e-10 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGGGG GG GGGG G GGG G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 61.7 bits (143), Expect = 8e-10 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGGGGG GG GGGG G GGG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 61.7 bits (143), Expect = 8e-10 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGGGGG GG GGGG G GGG GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 58.0 bits (134), Expect = 1e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGGG G GGGGGG GG GGGG G GG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGGGG GG G GG G G G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGGG G GGGGGG GG GGGG G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGGGGG GG GGGG GG G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 51.6 bits (118), Expect = 8e-07 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGGGGG G GGGG G GG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGGGGG GG GGGG G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G G GGGGGG G GGGG G GG G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 61.7 bits (143), Expect = 8e-10 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G GGGG GG GGGG G GGG GG G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGGG G G GGGG GG GGGG G GGG G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 55.2 bits (127), Expect = 7e-08 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GGG GGGG G GGGGGG G GGG G G GGG GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G GGGG GG GGGG GG G G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G GGGGGG G GGG G GG G G G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG----GXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G G GGGGG G G GGGG G GG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G G GGGGGG G G GG G GG G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGG-GDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXG 486 G G G + G G GGG GGGG GGGGGG G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG------GGGGGGGVG 114 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 60.5 bits (140), Expect = 2e-09 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PPP PP P PPPP P PPPP PPP P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAP---YPPPPYPPPPNP 185 Score = 60.1 bits (139), Expect = 2e-09 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPP-XPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP PP P PP P P PPPP P P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 59.7 bits (138), Expect = 3e-09 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P P PPP P PP P PP P PP P P PPPP P P P P+ Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Score = 58.8 bits (136), Expect = 5e-09 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP----PPXXPXXXXPPPPXXPPPXP 408 P PP PPP PPP PP PPPP PP P P PP PPP P Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 58.4 bits (135), Expect = 7e-09 Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPP-XPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PPPP P PPP PP P P PP PPP Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 57.2 bits (132), Expect = 2e-08 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPP 414 PPL PPP P PPPP P P PP PPP P PP P PPP Sbjct: 158 PPLYPPP-PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 56.8 bits (131), Expect = 2e-08 Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP-PPPPXXPXXXXPPPPXXPPP 414 P PP PP P PPP PP PP PPPP P P PP PPP Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPP--PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP P P PPP P PPPP P P PPPP P P P P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 56.8 bits (131), Expect = 2e-08 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP PPP PP P PP P P PPPP P P P Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 56.4 bits (130), Expect = 3e-08 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP PP P PPPP P P PPPP PPP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Score = 56.0 bits (129), Expect = 4e-08 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP--PPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPP P PPP PPP P P PP P PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 54.8 bits (126), Expect = 9e-08 Identities = 25/59 (42%), Positives = 26/59 (44%), Gaps = 6/59 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P PP PPP P PPP PP PPPP PP P P P P P P P+ Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPY 233 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP P PPP P P P PPPP P P P Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXP 408 PP P P PPP PP PPPPP P P PPPP P P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP-PPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPP P PPPP PP P P PP P P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Score = 52.0 bits (119), Expect = 6e-07 Identities = 23/55 (41%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPP-PPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PP PPPP PP PP PPP P PP P PPP +P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSP 144 Score = 51.6 bits (118), Expect = 8e-07 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP PP PP PPP P P PP PPP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP-----PPXXXPXPXPPXP 431 P P P P P P P PPPP P PPPP P P P PP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 430 XXXPPL 413 PPL Sbjct: 155 PYPPPL 160 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P P P P PP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 50.0 bits (114), Expect = 3e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PP PP P P P P PPP PPP P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 50.0 bits (114), Expect = 3e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PP P P PP PPP P P PP P PP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 49.2 bits (112), Expect = 4e-06 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP-PPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PP PPP P P PP P PP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 48.4 bits (110), Expect = 8e-06 Identities = 26/78 (33%), Positives = 27/78 (34%), Gaps = 5/78 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP-----PPXXXPXPXPPXP 431 P P P P P P P PPPP P PPPP PP P P PP Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNA 217 Query: 430 XXXPPLXXXXXXNXPFFP 377 P N P+ P Sbjct: 218 PNPPYPPPPNAPNPPYPP 235 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 1/72 (1%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP-P 418 P P P P PP PP PP P PP P P P PP P P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 417 PXXXXXXXTPLF 382 P PL+ Sbjct: 150 PPPNPPYPPPLY 161 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PP P P PPPP P P PP P PP Sbjct: 119 PPNAPYPPPPNPPYPPPPNA--PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPP-PPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PP PP PPPP P P PP P P P Sbjct: 188 PPPPNPPYPPPPNAPNPP--PPNPPYPPPPNAPNPPYPPPPNAPNP 231 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPP--PXXPPX-PPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP P PP PPPP P P P PP P PPP Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP--PPXXPPXPPPP------PPXXPRXPXPPXPXXPPP 415 P P PP PP PP PP PPPP PP P P P P PPP Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP-XXXPPLXXXXXXNX 389 P P P P P P P P PP PPP P P PP P PP N Sbjct: 126 PPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Query: 388 PFFP 377 P+ P Sbjct: 186 PYPP 189 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPP---PPPXXXPX--PXPPXPXXXPPLXXXXXXNXP 386 P P P P PPPP P PPP PPP P P PP P PP P Sbjct: 134 PPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Query: 385 FFP 377 +P Sbjct: 194 PYP 196 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPP----XXPRXPXPPXPX 427 P P P P P PPP PP P PPPP P P PP P Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Query: 426 XPPP 415 PPP Sbjct: 187 YPPP 190 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXP-PXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P P P P P PPPP P P PPPP P P PP P Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPPP P PP PPP P P P P Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 43.6 bits (98), Expect = 2e-04 Identities = 31/101 (30%), Positives = 32/101 (31%), Gaps = 2/101 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPP-PPXXPXPPP-PPPXXXPXPXPPXPXXXPPLXXX 404 P P P P P P PP PP PPP PPP P P PP P P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP-PYP 188 Query: 403 XXXNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXP 281 N P+ P P P PP P P Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPP--PXXPP--XPPPPPPXXPRXPXPPXPX 427 P P P P PP PPP P PP P PP P P P PP P Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Query: 426 XPPP 415 P P Sbjct: 236 PPNP 239 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 10/53 (18%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP------PXPP----PPPPXXPRXPXPPXPXXPPP 415 P PP PPPP P P PP PPPP P P P P PPP Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPP-PPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP P PP P P PPPP P P PP P Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/75 (29%), Positives = 24/75 (32%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXPFXXXXSXXP 326 PP P PP PPP P P PP P N P+ P P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP-PPNAPYPP 142 Query: 325 XXXXXFFXPPXPXXP 281 + PP P P Sbjct: 143 SPNAPYPPPPNPPYP 157 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPR 451 P P PP P PPP P PP PPP P+ Sbjct: 207 PNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQ 240 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 58.8 bits (136), Expect = 5e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGGGG GG G G G GGG GG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 58.8 bits (136), Expect = 5e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG GGG G GGGG G GGG GG G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 58.8 bits (136), Expect = 5e-09 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG GGGGGG GG GGGG G GGG GG G Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG G G GG GGGG G GGG GG G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 56.0 bits (129), Expect = 4e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGGG G GGGGGG GG GG G G G G GG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 56.0 bits (129), Expect = 4e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G GGG GG GGGG G GGG G G Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 55.2 bits (127), Expect = 7e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GG G GGGGGG GG GGGG G G G G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 55.2 bits (127), Expect = 7e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGGG GG GGGG G G G GG G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 55.2 bits (127), Expect = 7e-08 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGGGG GG GGG G GGG G G Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 54.8 bits (126), Expect = 9e-08 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXX----GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGGGG GG GGGG G GGG GG G Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 G GG GGGG G GGGGGG GG G GGG G G G GG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGGGG GG GG G G GGG GG G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGG-GGDGGGYGDGDGGGGGGGGG 820 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGGGG GG G G G GGG GG G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/72 (38%), Positives = 29/72 (40%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G + G G GGG GGG G G GGG G GGGG Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Query: 508 XGXGGGXRGGXG 543 G GGG GG G Sbjct: 852 GGGGGGGGGGGG 863 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGG G GG G GGGGGG GG GGGG G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GGGGGG GG GGGG G GGG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGG-GGGGGGGGGGDGGGYGDGDG 812 Score = 51.2 bits (117), Expect = 1e-06 Identities = 31/81 (38%), Positives = 32/81 (39%), Gaps = 9/81 (11%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG---------G 480 G G G + G G GGG GGGG G G GGG G Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Query: 481 XGGXXGGGGXGXGGGXRGGXG 543 GG GGGG G GGG GG G Sbjct: 846 DGGGGGGGGGGGGGGGGGGGG 866 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGGGGG GG GGGG G G G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G G GGGGGG G GG G G GG G G G G G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGGGGG GG G G GG G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GG GGG G GGGG GG G G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G G G GGGGG GG GGGG GG G G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDG 839 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GGGGGG G GGGG G GG G G G G Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G GG G G G G F G G GG G G Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Query: 462 XGGGGGGXGXXGGGGXG 512 GGGGGG G GGGG G Sbjct: 859 GGGGGGGGGGGGGGGGG 875 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G GGGGGG G GGGG G G G G G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G GGGGGG GG GGGG GG G G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GG G G GG GGGG GG G G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG GG G G GGGGGG G GG G G GG G G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GGGGGG G G GG GG G G G G G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G G GGG GG GGGG G G G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GG GG GGGG GG G G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 41.5 bits (93), Expect = 9e-04 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 1/86 (1%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXG-GXGXGX 458 G G GG G G G G GG G G G G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Query: 459 XXGGGGGGXGXXGGGGXGXXXXXXGG 536 GGGGGG G GGGG G GG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 41.5 bits (93), Expect = 9e-04 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG---GGGX--GXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G G GGG GGG G GGGG G GG G G G G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGG---GXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GGG G GG GGGG GG G G Sbjct: 821 GGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXG-XXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGGG G G GGG G G G G G G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Query: 594 G 596 G Sbjct: 865 G 865 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGG G GG GGG GG G G Sbjct: 812 GGGGGGGGGGGG-GGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G G GGG GGG G GG G G G G G G G G Sbjct: 808 GDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGG 867 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G GGGGGG G GGG GG G G G G Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGG 503 G G + GG G GG G G GGGGGG G GGG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG--GGG 876 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 57.6 bits (133), Expect = 1e-08 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P + PPP P PPP PP PPPPPP P PPPP PP Sbjct: 677 PIQTMVPPPPPPPPP---PPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 55.2 bits (127), Expect = 7e-08 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP P PPPPPP P P P P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 52.0 bits (119), Expect = 6e-07 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPPP PP PPPPPP PPPP PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 50.0 bits (114), Expect = 3e-06 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PPPP P PPPPPP P PP P PP+ Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPV 716 Score = 48.8 bits (111), Expect = 6e-06 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPPP PP PPPPPP P PPP P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P L P PPP PP PPPPPP P PP P PPP P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPP----PPQPSTPPPPP 710 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P+ P P PP PPPPPP P P P PPP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P PP PPPP P PPPPPP P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPPP P PPPP P P P P P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PPPPPP P PPPP PPP P P Sbjct: 675 PIPIQTMVPPPPPPPPPP----PPPPPPPPPQPSTPPPPP 710 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PP P PP PPP P + P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PPPPPP P P PP P P TP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG G GG G GG G GG GG Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 610 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +1 Query: 409 GXGGGXXGG--GGXXXXGXXGGG--GGGXGGXXGGG-GXGXGGGXRGG 537 G GG GG GG G GG GG GG GG G GG GG Sbjct: 572 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGG 619 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG G GG G GG G GG GG Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 636 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +1 Query: 409 GXGGGXXGG--GGXXXXGXXGGG--GGGXGGXXGGG-GXGXGGGXRGG 537 G GG GG GG G GG GG GG GG G GG GG Sbjct: 598 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGG 645 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PP P P P P PP P Sbjct: 700 PPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPP 744 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GG GG G GG GG GG G GG GG Sbjct: 580 GNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 624 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 E G GG GG GG GG GG G GG G Sbjct: 536 ENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 588 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG G GG G GG GG GG Sbjct: 423 GGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGG 462 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +1 Query: 415 GGGXXGG--GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG GG G GG GG G GG G G Sbjct: 609 GGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNSHSG 651 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP P P P P P PP P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG-GGXRGG 537 G GG GG GG GG GG G GG GG Sbjct: 563 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGG 606 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG-GGXRGG 537 G GG GG GG GG GG G GG GG Sbjct: 589 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGG 632 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G G GG G GG GG GG G GG GG Sbjct: 554 GNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 598 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP 485 P P P P PP P PPPP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG GG GG GG GG GG Sbjct: 418 GGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGG 457 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +1 Query: 415 GGGXXGG---GGXXXXGXXGGGGGGXGGXXGG---GGXGXGGGXRGG 537 GG GG GG G GG G GG GG GG GG Sbjct: 451 GGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGG 497 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG G GG GG GG GG Sbjct: 476 GGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGG 516 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG GG G GG GG GG Sbjct: 491 GGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGG 531 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGG 537 +K G GG G G GG GG GG G GG GG Sbjct: 421 DKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGG 477 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G GG GG GG GG G Sbjct: 433 GGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGG 477 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G G GG G GG G GG G GG GG Sbjct: 467 GNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGG 511 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG G G G GG GG GG Sbjct: 481 GGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGG 521 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG GG G GG GG GG Sbjct: 486 GGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGG 526 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G G GG G GG G GG G GG GG Sbjct: 501 GENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGG 545 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/53 (26%), Positives = 14/53 (26%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 E G GG GG GG G G GG GG Sbjct: 502 ENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGG 554 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG--GGXRGG 537 GG GG GG GG GG G GG GG Sbjct: 525 GGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGG 567 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +1 Query: 418 GGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG GG GG GG G G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 605 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +1 Query: 418 GGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG GG GG GG G G Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 631 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGG--GGGXGGXXGGG--GXGXGGGXRGG 537 GG G G G GG GG G GG G GG GG Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGG 615 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGG--GGGXGGXXGGG--GXGXGGGXRGG 537 GG G G G GG GG G GG G GG GG Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGG 641 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP 473 P P P P P PP PPPP P PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP--PSTPP 715 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G GGGG GG GGGG G G G GG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 55.6 bits (128), Expect = 5e-08 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGGGG GG GGGG G GGG GG G Sbjct: 88 GGGGGFGGGGGG---GFGGGGGGGFGGGGGGGG-GFGGGGGGGFG 128 Score = 54.0 bits (124), Expect = 2e-07 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GG GGG GG GGGG G GG GG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GG G G GGGGGG GG GGGG G G R Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRAR 132 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G GGGG GG GGGG GG G G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G+ G F GG G GG G G GGGGGG G GGGG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/56 (42%), Positives = 25/56 (44%) Frame = +2 Query: 383 KRGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +R V GG G GG G G GGGGGG GG GGG GG G G Sbjct: 70 RRRVKKTRASVGGRGGGFGGGG--GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G G G G GGGG G GGGG G GG G G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGGGG G GGGG G GG G G G Sbjct: 81 GGRGGGFGGGG-GFGG-GGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG GGG G GGGG G GG G G G G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GGGGG G GGG G GG G G G G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG--GXGXGGGXRGGXG 543 G GGG GGG G GG GGG GG GGG G G GGG RGG G Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/56 (44%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 382 KKGXXXXXXGXGGGX-XGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG-GGXRGGXG 543 ++G G GGG G GG G G GGG GG G GG G G GG GG G Sbjct: 125 QRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GGG GG GGGG G G G Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXRG 534 G G G GG G G GG GGGG G GGG G GG RG Sbjct: 156 GGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +1 Query: 409 GXGG-GXXGGGGXXXXGXXGGGGGGXG---GXXGGGGXGXGGGXRGG 537 G GG G GG G G GGGG G G G GGGG G G G RGG Sbjct: 158 GEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRG-RGG 203 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/58 (36%), Positives = 23/58 (39%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G +G + G G G G G GGG GG G GG G G GG G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRG 184 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 GG GG G GG G G GG G GGG G GGG GG G Sbjct: 122 GGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGG-EGGWG 163 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GG GGG GG G G GG G G Sbjct: 156 GGGEGGWGGRGGNG--GGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/67 (35%), Positives = 25/67 (37%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXX 557 G +G RGG GG G GG GGG G G GG G GG G G Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGG-GEGGGGRGRGTGGGSRGGGGD 195 Query: 558 XXGXXXG 578 G G Sbjct: 196 GRGRGRG 202 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 G G GG G G GGG G GGG G G G G GG G Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEG 160 Score = 34.3 bits (75), Expect = 0.13 Identities = 25/86 (29%), Positives = 29/86 (33%), Gaps = 2/86 (2%) Frame = +1 Query: 262 KKGXXXXGXXGXXXKKXXXXXXGXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGG-- 435 ++G G G + G G G + E G G GGG GG Sbjct: 120 RRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGE--GGWGGRGGNGGGRGGGEG 177 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXG 513 GG G GG GG G G G G Sbjct: 178 GGGRGRGTGGGSRGGGGDGRGRGRGG 203 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 RGG G G G G G G G G GG GG G G G G Sbjct: 121 RGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGG 175 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGG-----GGXGXXXXXXGGXXGXGXXXXGXXXG 578 RGG GG G G G G GG GG GG G GG G G G G Sbjct: 129 RGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGG 188 Query: 579 XXXXXG 596 G Sbjct: 189 SRGGGG 194 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXG-GXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GG G G G G GG G GG G G Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGG--GGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G GG GGG G G GG GG G G Sbjct: 130 GGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGG 175 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G G G G GGGG G G GG G G G Sbjct: 161 GWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 56.4 bits (130), Expect = 3e-08 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PPP P PPPP PP PPPPPP P PPPP P Sbjct: 464 PPPPPPPPPP--PPPPPPPPPPPPPPFPPPPPPTP 496 Score = 55.6 bits (128), Expect = 5e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPPP PP PPPPPP P P PP P PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 54.8 bits (126), Expect = 9e-08 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PPP P PPPP PP PPPPPP P PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP----PPPP 494 Score = 54.0 bits (124), Expect = 2e-07 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPPP PP PPPPPP P PPPP PPP P Sbjct: 464 PPPPPPPPPPPPPPP--PPPPPPPPPFPPPPPP 494 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P PPPP PP PPPPPP P PPP PPP P Sbjct: 464 PPPPPPPPP--PPPPPPPPPPPPPPPFPPP---PPPTP 496 Score = 53.6 bits (123), Expect = 2e-07 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP PPP P PPPP PP PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 51.2 bits (117), Expect = 1e-06 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P PP PPP P PPPP PP PPPPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PPPPPP P P PP P PPP TPL Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P PP PPPP PP PPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P PP PPPP PP PPPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P PP P PPPP P PPP PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP P PPPP P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPPPP PPPP PPP P PF Sbjct: 464 PPPPPP-------PPPPPPPPPPPPPPPPPPF 488 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFF 381 PPPPP PPPP PPP P P F Sbjct: 464 PPPPP-------PPPPPPPPPPPPPPPPPPPF 488 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP 479 P P P P PP P PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGGG G GGG GG GG GG G G GGG GG Sbjct: 175 GYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 Score = 54.8 bits (126), Expect = 9e-08 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGGG G GGGGGG GG GGG G GGG GG Sbjct: 180 GYGGGGHGGGG-YGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GG G GGGG G GGG GG G Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGG--YGGGGYGGGGGGYGGSG 207 Score = 52.0 bits (119), Expect = 6e-07 Identities = 26/53 (49%), Positives = 27/53 (50%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGGG G GGGG GG GGGG G GG GG G Sbjct: 162 RGRGRGGGGYGGGGYGGGGYGGGGH--GGGGYGGGGYGGGGGGYGGSGYGGGG 212 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGG GG G G G GGG GG G Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGG 175 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G GGGG GG GGGG G GG GG G Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYG 192 Score = 49.2 bits (112), Expect = 4e-06 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GGGG G GGGGG GG GGG GGG Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 48.4 bits (110), Expect = 8e-06 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGGG G GGG G GGG GG G Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGG-GYGGGGYGGGG 180 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGG GGG GG G GG G GGG GG G Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGG-GGYGGGGHGGGGYGGGG 195 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G GGG GG GG GGG GGG RGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGG 159 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXG---GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGGG G GG GGGG G GG GG G Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGH-GGGGYGGGGYGGGGGG 202 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G GGGG G G GGGG G GG G G G G G Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 RGG G GG G G GGG GG G GGG G G G G G G Sbjct: 166 RGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSG 225 Query: 594 G 596 G Sbjct: 226 G 226 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G G GG GGGG G GG GG G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG 187 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGG GGG G GG G G GG G G G Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGG-GXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G G GGG GG G GGG G G GG G G G G G Sbjct: 163 GRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/70 (34%), Positives = 25/70 (35%) Frame = +3 Query: 387 GXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G + RGG G G GGGG G G GGGG G GG G G G Sbjct: 146 GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Query: 567 XXXGXXXXXG 596 G G Sbjct: 206 SGYGGGGGYG 215 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG--GXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G G GGGGG G G GGGG G G G G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG GG GGG G G RGG G Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGG 170 Score = 41.5 bits (93), Expect = 9e-04 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXG-XXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G G G G GGGGG G GGGG G GG G G G G Sbjct: 140 GGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Query: 594 G 596 G Sbjct: 200 G 200 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/43 (55%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGX-GXGGGXRG 534 GGG GGG G GGGGG GG GGGG G GGG RG Sbjct: 124 GGGRRGGG---YGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRG 163 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXX 590 RGG G G G G GGG GG G GGGG GG G G G G Sbjct: 128 RGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG 187 Query: 591 XG 596 G Sbjct: 188 GG 189 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +2 Query: 383 KRGVXXXXXXXGGGXXGXGG--XGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +RG GGG GG G G GGGGG G GGGG GG G G Sbjct: 127 RRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/87 (31%), Positives = 31/87 (35%), Gaps = 1/87 (1%) Frame = +3 Query: 321 KXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXX-GGGGGGXGXXG 497 + G + G + G +G G G GG G G GGGG G G G Sbjct: 128 RGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG 187 Query: 498 GGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GGG G GG G G G G Sbjct: 188 GGGYG-GGGYGGGGGGYGGSGYGGGGG 213 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/72 (30%), Positives = 25/72 (34%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGG 470 G GG + G + G G + GG G G G G GG Sbjct: 157 GGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGG 216 Query: 471 GGGGXGXXGGGG 506 GG G G GGGG Sbjct: 217 GGYGGGRSGGGG 228 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 56.4 bits (130), Expect = 3e-08 Identities = 22/46 (47%), Positives = 23/46 (50%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP P PPP PP PPPP P P PPPP P P + P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Score = 56.0 bits (129), Expect = 4e-08 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP---XXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P PPPP PP PPPPPP P PPP P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP 259 Score = 50.0 bits (114), Expect = 3e-06 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP-PPXXPPPXP 408 P P PPPP P P PPPP P PP PP PPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 50.0 bits (114), Expect = 3e-06 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPP P P PP PP P P PP P PPPP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPP----PPPPPSPP 238 Score = 49.2 bits (112), Expect = 4e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP PP PPPPPP P P PPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P PP PPP P P PP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPP--PPPPSPPRP 240 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P PPPP PP P P PP PPP Sbjct: 219 PPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPPPP P P PP P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPP---PSPSPPRPPPPPP 234 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPP P P PP P P PP PP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP-PSPPRPLAAKLPEPPPIPNMPP 256 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPPP P P P P P P PP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P P PPPP P PR P PP P P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPP--PPPPSPSPPRPPPPPPPSPPRP 240 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PPPPPP P PPPP P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP-----PPPPPXXXPXPXPPXP 431 P P P P P P PPPP P P P PPP P P P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPP-------PPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP PP P PP P P P PPP Sbjct: 215 PPPPPPPPSPSPPRPPPPP-PPSPPRPLAAKLPEPPPIPNMP----PTLPPP 261 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPP---XXPXPPPPPPXXXPXPXPP 437 P P P P P P P P PP P PPP P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 7/50 (14%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-------PXPPPPPPXXPRXPXPPXPXXP 421 P P P PPPP P P PPP P P P P P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLP 267 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 54.8 bits (126), Expect = 9e-08 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GGGGGG GG GGGG G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGG GGGG G GGGGGG GG GGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGGGGG G GGGG G GG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGGGG G GGGG G G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GGGGGG G GGGG G GG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GGGGGG G GGGG G GG G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GGGGGG G GGGG G GG G G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 468 GGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGG G GGGG G GG G G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 54.8 bits (126), Expect = 9e-08 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PPP PP PPPPPP P PPP PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PPPP P PPPP P PPPP PPP P P Sbjct: 290 PVP-PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP PPPPPP P PP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPP----PPPPPPGDGGAPPPPPP 336 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP PPPP P PPPP P P PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PPPP P PPP P P PP Sbjct: 302 PAPPPPPPPGGAPPPPPPP--PPPPPGDGGAPPPPPPP 337 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -3 Query: 507 PPPPXX--PPXPPPPPPXXPRXPXPPXPXXPPP 415 PPPP P PPPPPP P P PPP Sbjct: 293 PPPPADGSAPAPPPPPP-----PGGAPPPPPPP 320 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXP--XPPXPXXXPP 416 P PPPP P PP P P PP P PP Sbjct: 290 PVPPPPPADGSAPAPP-PPPPPGGAPPPPPPPPP 322 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPP 494 P P P P P PP P PPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PPP P PPPP P PPPPP P PP PPP P P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 53.2 bits (122), Expect = 3e-07 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP PPPP PPPPPP PPPP PP P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPP----PPPXXPXXXXPPPPXXPPPXPXXXXK 393 P PP PP P PPP PP PPP PPP P PPPP P P K Sbjct: 367 PPPPTNKPPPP-PPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGK 419 Score = 51.6 bits (118), Expect = 8e-07 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPP PPPPPP P P PP P PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGP--PPPPPPTNGPPPPPPPTNGP-PPPPPPTNGPP 415 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PP P PPPP PPPPPP P P PP PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Score = 50.4 bits (115), Expect = 2e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P PP PPP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP PPPP PPPPPP PPPP PP + P Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKP 424 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPP----PPPXXPXXXXPPPPXXP---PPXPXXXXKXP 387 P PP PP P PPP P PPP PPP P PPPP P PP P P Sbjct: 347 PPPPTNNPPSP-PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Score = 50.0 bits (114), Expect = 3e-06 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPP P PPPPP P P PP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 49.2 bits (112), Expect = 4e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P PPP PPPPPP PPP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 7/49 (14%) Frame = -1 Query: 512 PXPPPPXXPPXPPPP----PPXXPXXXXPPPPXXP---PPXPXXXXKXP 387 P PPP PP PPPP PP P PPPP P PP P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGP 394 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP P PPPPP P P PP PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTP-PPPPPTNKPPPPPPPTNGPPPP 387 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX--PPXPPP---PPPXXPRXPXPPXPXXPPP 415 PP PPPP PP PPP PPP P PP P PPP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPP--PPP 390 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 9/49 (18%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXX---P------XPPPPPPXXXPXPXPPXPXXXPP 416 PP P PPPP P PPPPPP P PP P PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP 395 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP 474 P PP P PPP PP PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPXPP 436 P P PPPPPP P PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPP 462 P P PPPP PP PP P Sbjct: 72 PSTPAPPPPPPPPSSGPPLP 91 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 P P PPPP PPPP PP P K Sbjct: 72 PSTPAPPPP-------PPPPSSGPPLPPSNGK 96 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 497 PXXPPXPPPPPPXXPXXXXPPPP 429 P P PPPPPP P P PP Sbjct: 72 PSTPAPPPPPPP--PSSGPPLPP 92 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXP 446 P P P PPPPP P P Sbjct: 72 PSTPAPPPPPPPPSSGPPLP 91 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPP 465 P P PPPP PP PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG GGGG G G GGG G GGGG G GGG GG G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 293 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG GGGG G G GGG G GGGG G GGG GG G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG GGGG G G GGG G GGGG G GGG GG G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG GGGG G G GGG G GGGG G GGG GG G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG GGGG G G GGG G GGGG G GGG GG G Sbjct: 311 GVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGG 356 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGGG GGG G GGG GG G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 286 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG G GG G G GGG G GGGG G GGG GG G Sbjct: 304 GGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G GG GG GG GGGG GGG G G Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSG 361 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGGXG 543 G GGG GGGG G GG GG GG GG G G GGG GG G Sbjct: 297 GGGGGATGGGG-GATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGGG G GGGG GGG G GGG GG Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGG 326 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G G GGG G GGGG GGG G G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GGGG G G GGG G GGGG G GG G Sbjct: 325 GGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG GGGG G G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 286 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG GGGG G G G Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 293 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG GGGG G G G Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG GGGG G G G Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG GGGG G G G Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G GGG G GG GGG GG G G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 292 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G GGG G GG GGG GG G G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G GGG G GG GGG GG G G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G GGG G GG GGG GG G G Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVG 313 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G GGG G GG GGG GG G G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGG 320 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G GGG G GG GGG GG G G Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGG 341 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG G GG GGGG G G G Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGG 335 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG GGG G G G Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG G GGGG GG G G G G G Sbjct: 264 GGGATGGGGGATGGGGGATGGGGGATGGGGGA--TGGGGGATGGGGGATGVGGGATGGGG 321 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG G GGGG GG G G G G G Sbjct: 278 GGGATGGGGGATGGGGGATGGGGGATGGGGGA--TGVGGGATGGGGGATGGGVGATGGGG 335 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G G GGG G GGGG GG G G G G Sbjct: 306 GGGATGVGGGATGGGGGATGGGVGATGGGGGA--TGGGGGVTGGGGGATGGGGG 357 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = +3 Query: 414 RGGXXXGXGGX--GXGXXXGGGGGGXGXXGG--GGXGXXXXXXGGXXGXGXXXXGXXXGX 581 R G GG G G GGGGG G GG GG G GG G G G G Sbjct: 236 RSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 295 Query: 582 XXXXG 596 G Sbjct: 296 TGGGG 300 Score = 37.5 bits (83), Expect = 0.014 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGG-XXGGGGXXXXXXXGGXXGXG 550 GV GGG G GG G G GG GG GG GGGG G G G Sbjct: 311 GVGGGATGGGGGATG-GGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGGGG GGG G GG G G G Sbjct: 314 GGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGGGG GGG G GG G G G Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT 303 Query: 594 G 596 G Sbjct: 304 G 304 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGGGG GGG G GG G G G Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT 310 Query: 594 G 596 G Sbjct: 311 G 311 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGGGG GGG G GG G G G Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGAT 324 Query: 594 G 596 G Sbjct: 325 G 325 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGGGG GGG G GG G G G Sbjct: 279 GGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGAT 338 Query: 594 G 596 G Sbjct: 339 G 339 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGGGG GGG G GG G G G Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVT 345 Query: 594 G 596 G Sbjct: 346 G 346 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGG--GGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G G G G GGGG GG G GGG G G G G G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGG 326 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G G GGG GGG G GG G G G Sbjct: 293 GGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGAT 352 Query: 594 G 596 G Sbjct: 353 G 353 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 455 GXXGGGG--GGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGG GG GG GGGG G G G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGG 272 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 52.0 bits (119), Expect = 6e-07 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PP P PPPP P PPPPP P P PP P P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P PPP P PPPPP P PPPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P+ PP P PP P PPP P PPPP PPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPP--PPAAAPPPPPPPPP 249 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P PPPP P PP PPP P K P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P P PP P PP P PPPPPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 PP P P PPPP P P PP PP Sbjct: 215 PPEPDYLEPTPPPP-AAPAPPPPPAAAPPP 243 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGGG G G G GG GG GGGG G GG G Sbjct: 75 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GGGGG G GGGG G GGG GG Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGG-DGDGGGGGDGGGGGDGGG 111 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG G G G G GG GG GGG G GGG G G Sbjct: 67 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXX-GGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GGG G G Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG 97 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G GGGG G GG G G GGG GG G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGG----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G G GGG GG GG G G GGG G G Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG 99 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG-GXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GGG G G GGGG G G G G G G Sbjct: 55 GGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 109 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G GGGGG G GG G GG G Sbjct: 77 GGGCDGGGGDGD----GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGG 536 GG G G G GGGGG G GGGG G GG Sbjct: 73 GGGDGGGCDGGGGDGD-GGGGGDGDGGGGGDGGGGGDGGG 111 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GG G G GGG GGG G GGG G GG G G G Sbjct: 67 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG--DGGGGGDGGGGNDDDG 117 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGGG G G G GG GG GGGG G GG G Sbjct: 90 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GGGGG G GGGG G GGG GG Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGG-DGDGGGGGDGGGGGDGGG 126 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG G G G G GG GG GGG G GGG G G Sbjct: 82 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXX-GGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GGG G G Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG 112 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G GGGG G GG G G GGG GG G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGG----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G G GGG GG GG G G GGG G G Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG 114 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG-GXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GGG G G GGGG G G G G G G Sbjct: 70 GGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 124 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G GGGGG G GG G GG G Sbjct: 92 GGGCDGGGGDGD----GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGG 536 GG G G G GGGGG G GGGG G GG Sbjct: 88 GGGDGGGCDGGGGDGD-GGGGGDGDGGGGGDGGGGGDGGG 126 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GG G G GGG GGG G GGG G GG G G G Sbjct: 82 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG--DGGGGGDGGGGNDDDG 132 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPX-PPPPXXPPXPPPPPPXXPXXXXPPPPXX-PPPXPXXXXKXP 387 P PP P P PPPP P PPPP P PPPP PPP P P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = -1 Query: 533 PLXPPPXP------XPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP P PPPP P PPPP P PPPP PP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 48.4 bits (110), Expect = 8e-06 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPP--PPXXPPPXPXXXXKXP 387 PP P P PP P PPPP P PP PP PPP P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX--PPPPPPXXXPXPXPPXPXXXPP 416 P P P PP PPPP P PPPPPP P P P P PP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPPP P PPPP P P PP P PP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 8/54 (14%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPP--------PPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP P PP P PP PPPP P PPPP P P P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -1 Query: 533 PLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPP PP PP PP P PPPP P P PP PP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPP--PAQPAPQPPPAPP 110 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P PPPP P PPPPP P PP P Sbjct: 75 PPPPAAPPAAPPPPPPL--PAPPPPPAQPAPQPPPAPPHFLP 114 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PP P PPPP P PPPPP P P P P P Sbjct: 67 PPAAAPAAPPPPAAPPAAPPPPPPL-PAPPPPPAQPAPQPPPAPPHFLP 114 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPX--PPPPP-PXXPRXPXPPXPXXPP 418 PP PPPP PP PPPPP P P P P P PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPP-PPPPXXPRXPXPPXPXXPP 418 P P P P P PP PP PP P PP P P P P PP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP P PPP P PPP P PP PPL Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPP---PPPPL 91 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXP-XPPPPPPXXXPXPXPPXPXXXPP 416 P P PPPP P P PP P P P PP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPP 82 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP PP PPPPPP P PPPP PPP P Sbjct: 1157 PPP--PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 48.8 bits (111), Expect = 6e-06 Identities = 20/37 (54%), Positives = 21/37 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 + PPP P PPPP P PPPPPP PPPP P Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPP------PPPPPPTP 1186 Score = 47.2 bits (107), Expect = 2e-05 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP PPP P P P PP PPPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 PP PPP P PP PP PPPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 46.0 bits (104), Expect = 4e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P PP PPP P P PP PPPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P PP P PPPP P PPPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P PP P PP PP PPPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPP--PPPPPPPPPPTP 1186 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PPPPPP PP PPP P P Sbjct: 1157 PPPPPPPPPP------PPSSPSPPPPPPPPPPPP 1184 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = -3 Query: 477 PPPPPX----XPRXPXPPXPXXPPP 415 PPPPP P P PP P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 10/53 (18%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP----------XXPXXXXPPPPXXPPPXP 408 PP P P PPPP PP PPPPPP PPPP PPP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 11/54 (20%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXP-----------RXPXPPXPXXPPP 415 P PP PPPP PP PPPPPP P PP P PPP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P PPPPPP PPPP PPP P Sbjct: 93 PACPPACCAPPPPPPPP-------PPPP--PPPPP 118 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 13/62 (20%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPP-------------XXPXPPPPPPXXXPXPXPP 437 P P P P PP P PPPP P PPPPPP P P P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPP---PPPAPC 149 Query: 436 XP 431 P Sbjct: 150 MP 151 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP P PP P PP PP P P P Sbjct: 136 PAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMP 177 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPP-PPPPXXPXXXXPPPPXXPPPXP 408 + P P P PPPP P PP P PPP P Sbjct: 134 MHPAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAP 175 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -1 Query: 467 PPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PPPP PPP P P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 13/48 (27%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP------------PXXPPXPPPPP-PXXPXXXXP 438 P PP PPP P PP PP PPP P P P P Sbjct: 138 PPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMPAPPPMVVP 185 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP-----XPPPPPPXXPXXXXPPPPXXPPP 414 P PPL P PPPP PP PPPPP P PPP PPP Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = -1 Query: 524 PPPXPXPPPPXXP---PXPPPPPPXXP-XXXXPPPPXXPPP 414 PPP P PPPP P PPPPPP P PPPP P P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P P PP PPPPPP PPPP P P Sbjct: 726 PP--PPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 11/54 (20%) Frame = -1 Query: 542 PXPPLXPPPXPX----PPPPXXP-------PXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PPPP P P PPPPPP PPPP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = -1 Query: 524 PPPXPXP----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P P PP PPPPPP P PP PPP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPP-------XXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPPP PP PPPPPP P PP P P Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 9/54 (16%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPP-----PPPXXXPXP----XPPXPXXXPP 416 P P PP P PPPP P PPP PPP P P PP P PP Sbjct: 697 PPPPPPPLLSGTLPMPPPP--PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXP-RXPXPPXPXXPPP 415 P PP PP PPPPPP P PP P PPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPPP PPPPP P P P PPP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPP-------PPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P PP PPP P PPP P P PPP PLF+ Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAG-LPPPPPPIDVPMKPLFW 769 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP----XPPPPPP 463 P P P P P PPPP PP PPPPPP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 9/58 (15%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPP---------XXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PPPP P PPPPPP PP P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PPP P PPP PPP P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLP 710 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = -1 Query: 521 PPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P PPPP PP PP P P P P P Sbjct: 740 PPPPPPPPPGCAGLPPPPPPIDVPMKPLFWKRIQLKKPQPEP 781 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G GGGG GGG G GGG GG G Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXG----GGGXXXXGXXGGGGGGXGGXXGGGG--XGXGGGXRGGXG 543 G GGG G GGG G GG GG GG GGGG G GGG GG G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGG 101 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGGGG G GG G GG GG G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GG G GG GG G Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHG 143 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GGG GG GGG G GGG GG G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGG--GGGATGGGGGATGGHG 80 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG--GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G G G GGG G GGG G GGG GG G Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATG-GGGGATGGGGGATGGHG 115 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG-GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGGGG G GG G GG GG G Sbjct: 78 GHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVG 123 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GG GG G G G GGG G GGGG G GGG GG Sbjct: 126 GGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G GGG G GG GG GG G GG G GGG GG G Sbjct: 113 GHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGG 157 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG---GGXGGXXG--GGGXGXGGGXRGGXG 543 G GG GGGG G GGGG GG GG G GG G GGG G G Sbjct: 45 GHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGG 94 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGX-GXGGGXRGGXG 543 G G G GG G G G GG G GGGG G GGG GG G Sbjct: 119 GGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGG--XXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G GG GGG G GGGGG GG G GGG G GG G G Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATG 133 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-----GXGXGGGXRGG 537 G GGG GGGG G GG GG GG GGG G G G GG Sbjct: 91 GDGGGATGGGGGATGGG-GGATGGHGGATGGGVGATGGHGGATGGHGG 137 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG G GG G G G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGGXG 543 GG GGGG G GG GG GG GG G G GG GG G Sbjct: 94 GGATGGGGG--ATGGGGGATGGHGGATGGGVGATGGHGGATGGHG 136 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXX-GGGGGGXGXXGG--GGXGXXXXXXGGXXGXGXXXXGXXXGXXX 587 GG G G G G GGGGG G GG GG G GG G G G G Sbjct: 53 GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATG 112 Query: 588 XXG 596 G Sbjct: 113 GHG 115 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXR-GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG GG GGGG G G G Sbjct: 119 GGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GV GG G G G GG GG GG GGGG G G G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGG 87 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G GGGGG GG G G GG G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATG 91 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXG--GGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXX 590 GG G GG G G GGGGG GGG G GG G G G Sbjct: 65 GGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGA 124 Query: 591 XG 596 G Sbjct: 125 TG 126 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGGGG GGG G GG G G G Sbjct: 80 GGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGAT 139 Query: 594 G 596 G Sbjct: 140 G 140 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G GGGGG GGG G GG G G G G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATG 105 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G G GG G GG GGGG G G G Sbjct: 71 GGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHG 115 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG GG G G GGG G GGGG GG G G G G G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGA--TGGHGGATGGGGGATGDGGGATGGGG 101 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG GG G GGG G GG GGG GG G G Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGG 121 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GG G GG G G G G Sbjct: 99 GGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHG 143 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 420 GXXXGXGGX--GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 G G GG G G GGGGG G GG G GG G G G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDG 93 Query: 594 G 596 G Sbjct: 94 G 94 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GG G G G G GG GG GG GGGG G G Sbjct: 129 GGATGGHG-GATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G G GGGGG GG G GG G G G G Sbjct: 88 GATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATG 147 Score = 32.3 bits (70), Expect = 0.54 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXG--GGGGGX-GXXGG--GGXGXXXXXXGGXXGXGXXXXGXXXGX 581 GG G GG G G GGG G G GG GG G GG G G G G Sbjct: 100 GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGA 159 Query: 582 XXXXG 596 G Sbjct: 160 TGGGG 164 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGG 506 G G GG G GG G GGGG GGGG Sbjct: 123 GATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGX--GGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G GGGG GG GGG G GGG G G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGG 1807 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXX---GGGGXGXGGGXRGGXG 543 GGG GGGG G GGG G GG GGGG G GGG GG G Sbjct: 1776 GGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG G G GGGG GGG GG G Sbjct: 1768 GGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG 1814 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG--GGXRGGXG 543 GGG GGGG G G GGGG G GGG G G GG GG G Sbjct: 1800 GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGG-GXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGGG G GG GGG GG GG G Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGG 1802 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/42 (54%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXGGGXRG 534 GGG GGG G GGGG G GG GGGG G GGG G Sbjct: 1782 GGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEG 1823 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/42 (54%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 GGG GGG G GGGGG GG GG GG G G G GG Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGG 1829 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG G GGGGGG GG GG G G GG G G Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGG--GGEGMGAAGGGMGAGG 1835 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GGGG G GG GG GG GGGG GGG GG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGG-MGGGGMAAGGGEFGG 1794 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGGG G G G G G GG G G GGG G Sbjct: 1805 GGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXG-XXGGGGGGXGGXXGGG 504 G G G E G G GG GGGG G G GGG G GG Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGG 1838 Query: 505 GXGXGGG 525 G G GGG Sbjct: 1839 GAGGGGG 1845 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGG--GGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXX 587 GG G G G G GGGG GG G GGGG G G G G G G G Sbjct: 1783 GGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Query: 588 XXG 596 G Sbjct: 1843 GGG 1845 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGG-GGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GG GGGG G GGG GG G G Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGG---GGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGG GG G GGG G GG G G G Sbjct: 1771 GGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEG 1823 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G G G GGG G GGGG GG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGG-MGGGGMAAGGGEFGGGEGMG 1799 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G GGG GG G GG GG G G Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG 1814 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G G GGG G GG GGG GG G G Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GGGG G GG G GG G G Sbjct: 1781 GGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGG-GGXGXXGGGG--XGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G GGGG GG G GGG G GG G G G G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = +3 Query: 387 GXFXXXXXXRGGXXXGXGGX--GXGXXXGGGGGGXGXXGGG-GXGXXXXXXGGXXG 545 G F GG G GG G G GGGG G G GGG G G GG G Sbjct: 1790 GEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G GGGGGG GG G G G G G Sbjct: 1795 GEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGG 1839 Score = 36.3 bits (80), Expect = 0.033 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGG 470 G GG G G G G GG G G G G GG Sbjct: 1776 GGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 Query: 471 GGGGXGXXGGG 503 GGG G GGG Sbjct: 1836 EGGGAGGGGGG 1846 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGG---XGGXXGGG-GXXXXXXXGGXXGXG 550 GGG G GG G G GGGG GG GGG G GG G G Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GG G G GGGGG GGG G GG G G G Sbjct: 1757 GFGGGGGGGGMGGGGG-MAGGGGGMGGGGMAAGGGEFGGGEGMGG 1800 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G G GGGG G G GG G G G G Sbjct: 1805 GGGGGMGGGG--GGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG GGG G GG G G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEG 1797 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GGGG G G GG G GG G G G G G Sbjct: 1757 GFGGGGGG-GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMG 1799 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 3/75 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PP P PPPP P PPPPPP P PPPP PP P P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP--PPIAPAATVPAPAVPLA 184 Query: 371 XFXXXPXXXXXXPXP 327 P P P Sbjct: 185 AASPPPPSGGPPPPP 199 Score = 49.2 bits (112), Expect = 4e-06 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PPP PPPP PP PPPPPP PPP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 48.8 bits (111), Expect = 6e-06 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PPP PPP PP PPPPPP PPPP Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 48.4 bits (110), Expect = 8e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPP P PPPPPP P PPPP PP P P Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPP--PPIAPATGGPPP 166 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/64 (39%), Positives = 26/64 (40%), Gaps = 12/64 (18%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXP----PXPP-------PPPPXXPXXXXPPPPXXPPPXPXXX 399 P PP+ P P PPPP P P P PPPP PPPP PPP P Sbjct: 153 PPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILE 212 Query: 398 XKXP 387 P Sbjct: 213 LAAP 216 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPP P P P PPPPP PPPP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAP 146 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P P PPPP P P PP P PP Sbjct: 155 PPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPP PP PPPPPP P P PPP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = -2 Query: 577 PXXXPXXXXPXPXXP-----PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P P P P PPPP P PPPPP P PP Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP------XPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + P PPPP P PPPPP P PPPP PP P P Sbjct: 98 PTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPP--PPIAPATGGPPP 153 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXPR--XPXPPXPXXP 421 P P P PPPP P PPPPPP P P PP P P Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP PP PPPPPP P PPP Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -2 Query: 550 PXPXXPPXXXXXX-PXPPPPXXP---XPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPPP P PPPPPP PP P P Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXPPXP 431 P P P P P P PPPP P PPPPP P P P Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAP 179 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 12/66 (18%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP------------XPPPPPPXXXPXPXPPX 434 P P P P P P PPPP P PPPP P P PP Sbjct: 142 PPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPP 201 Query: 433 PXXXPP 416 P PP Sbjct: 202 PPPPPP 207 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/94 (26%), Positives = 26/94 (27%), Gaps = 4/94 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPF 383 P P P P PPPP PPPPPP PP P P P Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 382 FPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXP 281 P + P PP P P Sbjct: 171 APAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP--XPPPPPPXXP--RXPXPPXP- 430 P P P P PPPP P PPPPPP P P P P Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPL 183 Query: 429 --XXPPP 415 PPP Sbjct: 184 AAASPPP 190 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = -1 Query: 536 PPLXPP----PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPL P P P P PPPPP P P PPP Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPP 130 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 8/61 (13%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPP--------XXPXPPPPPPXXXPXPXPPXPXXX 422 P P P P PPPP P PPPPP PP P Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIA 145 Query: 421 P 419 P Sbjct: 146 P 146 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 49.6 bits (113), Expect = 3e-06 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPP PPP P PPPP PPPP PPP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP---PPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 P PP P P PPP P P PP P P PPPP PPP P K Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRK 997 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P PPP P PPPPP PPP PP P Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPP 956 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP----PXXPPXP---PPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PPP P PP P PPPP P PPP PP P Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLP 974 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP PP PPPP P P PP P PP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PPPP PPPPPP P P PP Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPP--PPPPPPP 994 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPP P P PP PP Sbjct: 915 PGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPPP PPP P P PP PP Sbjct: 925 PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPP 984 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPP P PPPP P PPP P PPPP PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPP--PGGNAPPPP--PPP 959 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 11/63 (17%) Frame = -1 Query: 542 PXPPLXP----PPXPXPPPPXXPPXPPP-----PPPXXPXXXXPPPP--XXPPPXPXXXX 396 P PP P P P PP PP PPP PPP PPPP PPP P Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Query: 395 KXP 387 P Sbjct: 991 PPP 993 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP-XXXPXPXPPXPXXXPP 416 P P P P PP PPP PPPPPP P P P PP Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP------PXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PP PPP P PP P PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXX--PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PPPP P PPPPP P PP PP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP 954 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPP PPPPP PP PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPG-GSAPPPGGGAPP 972 Query: 415 LXXXXXXNXP 386 L + P Sbjct: 973 LPPPPGGSAP 982 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPPPPP PPPP P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAP 942 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 11/55 (20%) Frame = -1 Query: 518 PXPXPPPPXXPPXP---------PPPPPXXPXXXXPPPP--XXPPPXPXXXXKXP 387 P PP PP P PPPPP PPPP PPP P P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPP-XXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P PP PPPPPP P P PP P N P Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAP 953 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGGG G GGGG GG GGG GGG RGG Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGGGGG G G GG GGG GG G Sbjct: 750 GYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGX-GXGGGXRGGXG 543 G GGG GGG GG G GG GGGG G GGG RGG G Sbjct: 731 GRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGG 777 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGG G GGGG G GG GG G G + G Sbjct: 766 GGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSG 808 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGG G GGGGG GG GGG GGG GG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G RG G GGGG GG GGGG GG G G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGG-GGYRGGGGYGGGHRGGGGYGGG 791 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G G GGG GG G GG G G G G G G Sbjct: 769 GGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSG 822 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGGG G GG G G GG G G G G Sbjct: 777 GYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYG 818 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/75 (33%), Positives = 28/75 (37%) Frame = +3 Query: 327 GXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGG 506 G W G + G G + +GG GG G G GGGG G GGGG Sbjct: 721 GGWQKDYQRGG--RGGGGYGGGYNDRRMQQGGYGNRSGG-GYRGGGGYGGGGGGYRGGGG 777 Query: 507 XGXXXXXXGGXXGXG 551 G GG G G Sbjct: 778 YGGGHRGGGGYGGGG 792 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 RGG G GG G GGGG G G GGGG G G G Sbjct: 760 RGGGGYGGGG---GGYRGGGGYGGGHRGGGGYGGGGHRGGSYSG 800 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGGG G G G GG G G Sbjct: 771 GYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSG 815 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG----GGXGGXXGGGGXGXGGGXR 531 GGG GGGG G G GG G GG G G GG R Sbjct: 784 GGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGGYNR 826 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 447 GXGXXXGGG--GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GGG GGG GGGG GG G G G G Sbjct: 750 GYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRG 795 Score = 28.3 bits (60), Expect = 8.8 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 10/71 (14%) Frame = +3 Query: 414 RGGXXXGXGG----------XGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXX 563 RGG G G G G GGG G G GGGG G GG G G Sbjct: 729 RGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGG---YRGGGGYGGGHRGG 785 Query: 564 GXXXGXXXXXG 596 G G G Sbjct: 786 GGYGGGGHRGG 796 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGGG G GGGGGG GG GG G G G G G G Sbjct: 302 GDGDGDGGGGG--DGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDG 344 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGGG GG G G G G G G G Sbjct: 308 GGGGGDGGGGG----GGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGG GG G G G G G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G G GGGGGG GG GG G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGGG G G G G G G G G G G G Sbjct: 314 GGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GGGG G GGG G G G G G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G GG G G GGGGGG G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GGG GG G G G G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGG GGG G G G G G G G G G Sbjct: 321 GGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 468 GGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGG G GGGG G GG G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG G GG G G G G G G G G G R Sbjct: 320 GGGGGG-GDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWGVR 359 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGG-GXGGXXGGGGXGXGGGXRGG 537 G GGG GG G G GGGGG G GG G G G GG GG Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GGG G GGGG G GGG GG G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG-GGAG 83 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G G G GG GGG G G GG G GGG GG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNG 69 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGGXG 543 G GGG GGGG G G G G G GG GG G GG GG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G G G G GG GGGG G G G GG G Sbjct: 71 GGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG-GVGGNGGSG 114 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG G G G GG GG GG G G G GG GG Sbjct: 44 GNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G GG GGG G GGGG GG G G Sbjct: 48 GAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G G G GGG G GG G GG G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGG 81 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G GG GG G GGGG G G G G Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G GG G GGG G GG G G G G G G Sbjct: 52 GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAG 96 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGGG-GXGGXXGGGGXXXXXXXGGXXGXG 550 GV GGG G G G G GGGGG G GG G G GG G Sbjct: 52 GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G G G G GG G GG G G G G G G Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGG---GGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXX 587 GG GG G G GG GGG G GGGG G G G G G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNV 99 Query: 588 XXG 596 G Sbjct: 100 GGG 102 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GV GGG G G G G GGG G GGGG GG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G G GG G G G G GG G G G G Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G GG GGG G GG G G G G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGG 80 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GV GG G G G G GG GG G GG GG G Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G G GG G GG GG G G Sbjct: 67 GNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGG-GGXGGXXGGGGXXXXXXXGGXXGXG 550 GV G G G G G G GG G GG GG G GG G G Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G GGGG G G GGGG G G G G G G Sbjct: 54 GAGGCGCGGGNDGGN-GGGGAGNG-GGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/77 (28%), Positives = 22/77 (28%), Gaps = 2/77 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G GG G G G G GG G G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Query: 462 XGG--GGGGXGXXGGGG 506 GG GGGG G GG G Sbjct: 95 AGGNVGGGGSGGVGGNG 111 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/41 (53%), Positives = 22/41 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGG GG GGG GG GGG G GGG GG Sbjct: 189 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G GG GG GG GGGG G G G GG G Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/56 (46%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXRGGXG 543 E+ G G G G GG G GG GGGG GG GGGG G GGG R G Sbjct: 181 ERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG-GYGGGRRDYGG 235 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG G G GGG G GG GGG GGG +GG Sbjct: 198 GYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GGG G GGGGG GG GG GGG Sbjct: 206 GYGGGRGGGG---YGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGGG G G GGGG G GG G Sbjct: 196 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXG-GGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GG GGG G G GGG G GG G G Sbjct: 190 GGYRSGGGGYG-GSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKG 239 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G G GGG GG GGG G GG G G Sbjct: 200 GGSSRGGYGGGRG---GGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 RGG GG G GG G GG G G GG G G Sbjct: 182 RGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 R GGGG GG GGG GG G Sbjct: 179 RNERGGGGSQGGGYRSGGGGYGGSSRGGYGG 209 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX-PPPPPPXXPXXXXPPPP-----XXPPPXP 408 P PPP P PPP PPPPPP P PPPP PPP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 8/46 (17%) Frame = -1 Query: 542 PXPPLXPPP------XPXPPPPXXP--PXPPPPPPXXPXXXXPPPP 429 P PP PPP P PPPP P PPPPPP PPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPPPPP PPPP PPP P P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPP--PPPLPGGAAPPP 691 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPX---PPPPPPXXXPXPXPPXP 431 P P P P PPPP P PPPPPP P PP P Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P PP P PPPP PPPPP Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P P P P PPPP PPPPPP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG G GGGGGG GG GGGG G GGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGG----XXGGGGXGXGGG 525 GGG GGGG G GGGGGG GG GGG G GG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG---XGGGXRGGXG 543 GGG GGG G GGGG G GG GGGG GGG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXG 513 G GGG GGGG GGG G GG G G Sbjct: 93 GVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGGG G G GGGG G GG G G Sbjct: 74 GGGDTDGGGGCG-G--GGGGGGGVGGGGGGGGGGG 105 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 464 GGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG GGGG GG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGG 102 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGGG GG GGG GG GGG GGG +GG Sbjct: 109 GGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGG 151 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/55 (41%), Positives = 25/55 (45%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 + +G GG GGG GG GGG GG GGG G GGG GG G Sbjct: 81 QPRGERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRG-GGGYGGGRG 134 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G GGG G GG GG G G GGG R G Sbjct: 102 GYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGG 146 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXG-GGXRGG 537 G G G GG G GG GGGG GG GGGG G G GG GG Sbjct: 95 GYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGG 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 GGG GG G GGGG GG GGG G G GGG GG Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXX--GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGGG G GGG GG G G GG G GGG GG G Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYG 138 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 RGG G GG G G GGGG G G GGG G GG G G Sbjct: 108 RGGYGGGRGGGGYGGGRGGGGYG-GGRGGGYGGGRRDYGGGSKGGG 152 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGG 505 RG GG G GG G G GGG GG GGG Sbjct: 108 RGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +3 Query: 381 KKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 + G + GG G G G G GGG G G GGG G Sbjct: 92 RAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG 135 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 +G G GGG GGG G GGG GG GGG Sbjct: 115 RGGGGYGGGRGGGGYGGG---RGGGYGGGRRDYGGGSKGGG 152 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GG GG GGG GG G G Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGG-RGGGGYGGGRGGGGYGGG 132 Score = 28.7 bits (61), Expect = 6.7 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 417 GGXXXGX--GGXGXGXXXGG-GGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GG GGG G GGG G G G G Sbjct: 100 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 4/59 (6%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGG----GXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G GGGG G GGG G G G G G G G Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYG 145 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPPP 429 PP PP PPP P P PPPPPP P PPPP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX---PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + P P PPPP PP PP P P PP PPP P Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + P P PP PP PPP P PPP PPP P P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPP--PPPEPPEECPPP 589 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P PP P PP P PPPPPP P PP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P P PP PPPPP P PP P Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPP--PXXPXPPPPPPXXXPXPXP 440 P P P P P PP P PP P P PPP PP P P P Sbjct: 540 PIPAVAPAVTPSEEPPPP--PPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PPPP PPP P PP P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPP 436 P P P PP P PPPP P P PP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPP P PPPP P PPPPP P PPPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPP--PPFGAPPPP 224 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P P PP P PPPP P PPPP P PPP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPP---XXPPP 414 P P PP PPPPPP P PPPP PPP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP PP PP P P PPPP PP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAP--PPPPPPFGAPPPP 224 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 511 PXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPP 416 P PPPP P PPPPP P PP PP Sbjct: 199 PPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPP 470 P P PP P PPPP PPPP Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P PP PPPP P PPPP P Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGP 230 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPPPP P P PPP P P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP 474 PP PPP PPPP PP Sbjct: 211 PPPPPPPFGAPPPPALNGGPP 231 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G GGG G GGG G GG GG G G GGG GG G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXX-GXXGGGGGGXGGXXGGG-GXGXGGG 525 G GGG GGGG G GG GGG GG GGG G G GGG Sbjct: 444 GDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGG-XGXRGXXGGGGGGXGGXXGGG 505 GV GGG G GG G G GG GGG GG GGG Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGX--GXGGGXRGGXG 543 G G G G G GG GGG GG GG G G GGG GG G Sbjct: 429 GDSDGCSSGVGDGRGGDGGGDGGG-GGDGGGDGIDGGDGGGDGGGDG 474 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGG G G GGG G GG G G Sbjct: 441 GRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = +1 Query: 415 GGGXXGGGGXXXX--GXXGGGGGGXGGXXGGGGXGXGG--GXRGGXG 543 GGG G G G G GG GG GGGG G GG G GG G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGG-GDGGGDGIDGGDG 466 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G GGG G G GGG G GG G G G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGG G GGG G GG GGG GGG R G Sbjct: 314 GRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/53 (41%), Positives = 24/53 (45%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 + +G GGG GGG GG GGG GG GGG G GG GG Sbjct: 86 QPRGERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G GG GG GG GGGG G G G G G Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G GG GG GG G G GG RGG G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG 133 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/56 (44%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXRGGXG 543 E+ G G G G GG G GG GGGG GG GGGG GGG R G Sbjct: 90 ERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG-SYGGGRRDYGG 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/36 (58%), Positives = 21/36 (58%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GGGGG GG GGG G GGG RGG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGR-GGGRGYGGG-RGGGG 345 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG GG G GG GGG R G Sbjct: 314 GRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 416 GGGXXGXGG--XGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GG GG GGGG GG G G Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXG-GGGXGXXXXXXGGXXGXG 551 GG G GG G G GG GGG G G GGG G GG G Sbjct: 99 GGYRSGGGGYG-GSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYG 143 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGG 536 RGG G G G GGG GGG G GG G G GG Sbjct: 311 RGGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GGG G GGG G G GGG G G GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G G GGG GG G GG G GG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 RG GGGG GG GGG GG G Sbjct: 88 RGERGGGGSQGGGYRSGGGGYGGSSRGGYGG 118 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGX----GXXGGGGXGXXXXXXGGXXGXG 551 G G G G G GGGG G G GG G G GG G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +3 Query: 453 GXXXGGG--GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GGG GGG GGG G GG G G G G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG---XGGGXRGGXG 543 GGG GGG G GG GG GG GGGG G GGG GG G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHG 225 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG G G GG G G GGG GG G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GGG GGG GG GGGG G GG G G Sbjct: 194 GYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GGG GGG G G GGG GG GGGG GGG +GG Sbjct: 201 GYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXG-GGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G GGG GGG G GGG G GG GG G G GG GG G Sbjct: 175 RGDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGG 228 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Frame = +2 Query: 380 KKRGVXXXXXXXGGGXXGXGGX--GXRGXXGGG--GGGXGGXXGGGGXXXXXXXGGXXGX 547 K RG GGG GG G +G GGG GGG GG GGGG GG G Sbjct: 173 KPRGDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Query: 548 G 550 G Sbjct: 233 G 233 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGG-GXGXXXXXXGGXXGXG 551 +GG G GG G G GGGG G G GGG G G GG G G Sbjct: 199 KGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 KG G GG G GG G GGGG G GG GG GGG Sbjct: 199 KGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 417 GGXXXGXGGXGX---GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G G GGGG G GGG GG G G G Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYG 238 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGG-GGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG GG G G GG GGG G GGG G GG G G Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKG 243 Score = 34.3 bits (75), Expect = 0.13 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGX---GXXGG-GGXGXXXXXXGGXXGXGXXXXGXXXGXXX 587 G G G G G GGGG G G GG GG G GG G G G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRH 235 Query: 588 XXG 596 G Sbjct: 236 DYG 238 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 GG G GG G G GGG GG G GGG Sbjct: 212 GGGRGGGGYGG-GHGGGGYGGGGRHDYGGG 240 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/37 (59%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGG-GXGGXXGGGGXGXGGGXRGG 537 GGGG G GGGGG G GG GGGG GGG GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GG G GG G G GGGG GG GGGG GG G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GGGG G GGGGG GG G GGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GG G GGGGG GG GG G GGG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G GGGG G GG GGG G GG + G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYG 136 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = +1 Query: 382 KKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 ++G G GGG GGG G GGGGG GGGG G Sbjct: 98 ERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 E+ G GGG GGGG G GGGG GGGG G Sbjct: 98 ERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GG GGG G GGGG G GG G G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 RGG G G G G GGG G GGGG G GG G G Sbjct: 99 RGGRGGGGGYGGGGGYGGGGRSYGG--GGGGGGFYQDSYGGGGGGG 142 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 380 KKRGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 ++RG GGG GG G GGGGG GGGG Sbjct: 97 RERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGG 139 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G GGGG GGG G GG G G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 5/74 (6%) Frame = -1 Query: 533 PLXPPPXPXPPP---PXXPPXPPPPPP--XXPXXXXPPPPXXPPPXPXXXXKXPFFSXXX 369 PL PP P PPP P PP P PPP P PPPP P P P + Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPA 1099 Query: 368 FXXXPXXXXXXPXP 327 P P P Sbjct: 1100 HPTEPPPRQPKPTP 1113 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P PP P P P P PPP P P P Sbjct: 1069 PAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTP 1113 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P P PP P PPP P P PP P P Sbjct: 1047 PSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNP 1098 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXP-PPPXXPPPXPXXXXKXP 387 P P P PP PP P PPP P P P PPP P P P P Sbjct: 1020 PGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPP 1073 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP P PP P PR P PP P P Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVP 1086 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PPP P PPP P P P P PP Sbjct: 1029 PKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PPP P P P PP Sbjct: 1047 PSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX---PXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P P PPP P PPPP P P P P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIP 1095 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPP-PPPXXPRXPXPPXPXXPPP 415 P P PPP P PPP P P P PP PPP Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPP P P P P P P P P Sbjct: 1062 PSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPP-PPPPXXPRXPXPPXPXXPPP 415 P P P PPP P PP PPP P PP P P P Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP-PRQPDP 1093 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -1 Query: 524 PPPXPXPPP---PXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP P PP P PPP P P PP P + P Sbjct: 1028 PPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQP 1076 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP-----XXPXXXXPPPPXXPPP 414 P P P P PPP P P P P P PPPP P P Sbjct: 1091 PDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKPKP 1138 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 + P P PP P P PP P PPP P P P Sbjct: 1011 IDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPP 1051 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP P PP P P P P P P P P P Sbjct: 1069 PAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKP 1111 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P L PP P P PP PP P P PPP P P P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPS-AVPIPPPRKPSP 1064 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPP P PPP P P P P PPP Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPPRQPD-PIPTNPAHPTEPPP 1106 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP--PPXXPRXPXPPXPXXPPP 415 P P P PP P PPP P PR P PP PP Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 10/54 (18%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXP------PPPXXPXPPP----PPPXXXPXPXPPXPXXXP 419 P P P P P PP P PPP PPP P P P P P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPP 1066 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP P P P P P P P P P Sbjct: 1071 PPPRQPPPPSTSQPVPPP-RQPDPIPTNPAHPTEPPPRQPKPTP 1113 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPP P P P P PPP P P P Sbjct: 1086 PPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPP--PXXPPXPPPPPPXXPRXPXPPXPXXP--PP 415 P P P PPP P P P PP P P P P PP Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 6/46 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPP------PXXPPXPPPPPPXXPRXPXPPXP 430 P PP PPP P P P PPP P+ P P Sbjct: 1072 PPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/59 (28%), Positives = 18/59 (30%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXP-------PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP+ P P P P P P P P PP P P P P Sbjct: 993 PSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPP 1051 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -3 Query: 534 PPXXXXXXXPPP-PXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PP PP P PP PR P PP P P Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPP--PRKPSPPPSAVPIP 1057 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G GG GG GG GG G G GG GG G Sbjct: 785 GSSGGANGGAGSSSGGASGGAGGSSGGASGGAG-GSSGGASGGAG 828 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG GG GG GG G GG G G Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG G GG GG G G GG GG G Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAG-GSSGGASGGAG 817 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG GG GG GG GG G GG G G Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASG 825 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G GG GG GG GG G GG G G Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGG 807 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG G GG GG GG GG G G G G Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GG G GG G G GG G GG GG Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGG 811 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG GG G GG GG G GG G GG Sbjct: 803 GGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 + G G GG G GG GG G GG G GG G G Sbjct: 760 DSSGGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASG 814 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GG G GG GG G GG GG GG Sbjct: 795 GSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGG 837 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GG G GG GG G G G GG GG Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G GG GG G GG G GG G G G Sbjct: 784 GGSSGGANG-GAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G GG GG G GG G GG G G G Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASG 825 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G GG GG G GG G GG G G G Sbjct: 766 GHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASG 814 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G G GG G GG G G G Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G GG G GG G G G G G Sbjct: 788 GGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G G GG GG G G G G G G G Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSG 832 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G GG GG G GG GG G G G Sbjct: 766 GHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGG 818 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXP-PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PPP P PPPP PP PPPPPP P P P Sbjct: 860 PRPRPRRPPPPPPPPPP--PPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PP PPPPPP PP P PPP TP Sbjct: 862 PRPRRPPPPPPPPP-------PPPPPPPPPPASSTGSTP 893 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPP 466 P P PP PPPP PP PPPPP Sbjct: 862 PRPRRPPPPP----PPPPPPPPPPPPPP 885 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P PPPP P PPPPPP Sbjct: 860 PRPRPRRPPP------------PPPPPPPPPPPPPPPP 885 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/70 (37%), Positives = 27/70 (38%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G + G G GGG GG G G GGGG GG GGGG Sbjct: 147 GDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG-GDDGGGSGGGGDDGGSDGGGG 205 Query: 508 XGXGGGXRGG 537 GG GG Sbjct: 206 GNDGGRDDGG 215 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG G G GGG G GG G GG GG G Sbjct: 147 GDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSG 192 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG---GGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G GGG GG GGG G GGG GG G Sbjct: 137 GDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG 184 Score = 35.1 bits (77), Expect = 0.077 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +1 Query: 409 GXGGGXXGG---GGXXXXGXXGGGGGGXGGXXGGGGX--GXGGGXRGGXG 543 G G G GG GG G GG G GG GG G G G G G G Sbjct: 149 GDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDG 198 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G G GGG GGG G GG G G G G G Sbjct: 151 GDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDG 209 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXG--GGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGG G GG GG GG G Sbjct: 169 GGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/57 (42%), Positives = 25/57 (43%), Gaps = 5/57 (8%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPP---PPXXPPPXPXXXXKXPFFS 378 P PP PPPP PP P PPPP P PP PP PP K P+ S Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPPYKS 178 Score = 45.2 bits (102), Expect = 7e-05 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP 438 P PP+ PPP P PPP P PP PP P P Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPP--PPPPXXPRXPXPP--XPXXPPP 415 PP PPPP PP P PPPP P P PP P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP--XPXXXPPLXXXXXXNXPF 383 P PP P PP P PPPP P P PP P PP P+ Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAP-PVPPTEAPPTAPPTGGSCVSKPPY 176 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P PP PPPP P PP PP P P Sbjct: 132 PPPVTPPPGPET---PPPPDTPAPPVPPTEAPPTAPP 165 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGGGG GG GGGG G GGG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGGGGG GG GGGG G GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGGG G GGGGGG GG GGGG G G G Sbjct: 53 GGGGG---GGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGGG G GGGGGG GG GG G G Sbjct: 53 GGGGGGGGG----GGGGGGGGGGGGGGGGDGDDDDG 84 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G GGG GGGG G GGGGGG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 GGG G GG G G GGGGGG G G GG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGGG G GGGGGG G G GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 471 GGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GGGG G GGGG G GG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXP 408 P PP+ PP PP PP PP PPP PP P PPP P P Sbjct: 183 PIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/48 (47%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = -1 Query: 536 PPLXP--PPXPXPPP--PXXPPX--PPPPPPXXPXXXXPPP-PXXPPP 414 PP+ P PP PPP P PP PPP PP P PPP P PP Sbjct: 156 PPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ P P PP PP PP P PP PPP P Sbjct: 169 PPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP 211 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP+ P P PP PP PP P PP PPP Sbjct: 182 PPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P P P P P PP P PPP P P PP+ P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Query: 385 FFP 377 FP Sbjct: 223 IFP 225 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P PP+ PP PP P P PPP P P P Sbjct: 196 PIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP--XPPPPPPXXPXXXXP--PPPXXPPPXP 408 P P PP P PP PP P PP P P PP PPP P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP 198 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -1 Query: 533 PLXPPPXPXPP-PPXXPPXPPPPP--PXXPXXXXPPP-PXXPPP 414 P P P PP P PP PPP P P PPP P PP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPP 190 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP P PP PP P P P P P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPP--PIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP-XPXPPXPXXXPP 416 P PP P P PPP PP P PP P PP Sbjct: 160 PIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX--PPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P PP P PPP P P P P P Sbjct: 176 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQP 227 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/70 (27%), Positives = 20/70 (28%), Gaps = 3/70 (4%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPPXXXPXPXPPXPXXXPPLXX 407 P P P P PPP P PP PPP P P PP+ Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Query: 406 XXXXNXPFFP 377 P P Sbjct: 203 PRTQPPPIPP 212 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PP PP PP PP P P P PP TP Sbjct: 177 PRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -3 Query: 507 PPPPXXPPXPPPPP--PXXP-RXPXPPXPXXPPPXXXXXXXTPL 385 P P PP PPP P P R PP P PP P+ Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPI 200 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXP-----PPPXXPPPXP 408 PP+ PP P PPP PP PPP P P PPP PPP P Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP 284 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP PPP PP PP PPP PP P Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP---PPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PP PP P PP PPP P PPP P P P Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPP 276 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXP--------PXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP PPP P PP PP P PP PPP P Sbjct: 249 PPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP---PPXXXPXPXPP 437 P P P P P PP PPP P P PP PP P PP Sbjct: 244 PHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP+ P PPP PP P PP P PPPP PP Sbjct: 264 PPMGMPGMGGMPPPGMPP-PMPPGGMPPNMEQPPPP--PP 300 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PP P PP PPPPP PP P Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPPPPPSSGVSNSGMMPPHMQNP 317 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP P PP P PP P P PP Sbjct: 243 PPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPX----PXPPXPXXXPP 416 P PP P PPP PP PP P P P P PP Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 10/55 (18%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPX--------PPP--PPPXXPRXPXPPXPXXPPP 415 P PP PPP PP PPP PPP P P PPP Sbjct: 244 PHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP 298 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P PP PP PP PPP PP P Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPPPPPSSGVSNSGMMPPHMQNP 317 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP PP PPP P P P PP Sbjct: 225 PMIPPVGMLGH-PPMGAPPPPHSMPPPGMPPPGMMPPPGFPP 265 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P PPP PPPPPP PPP PP P P Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PPP PP PPPP P PP PPP Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXX--PPPXP 408 PP PPP PPP PP PP PPPP PPP P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 41.5 bits (93), Expect = 9e-04 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXX 357 PP PP PPPP PPP P PPP PPP P P S Sbjct: 338 PP--PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Query: 356 PXXXXXXPXP 327 P P P Sbjct: 396 PPPGRGAPPP 405 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXP-RXPXPPXPXXPPP 415 P PP PPP PPPPPP + P PP PPP Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP 348 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 9/61 (14%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPP-----PPPXXPXXXXPPPP----XXPPPXPXXXXKX 390 P PP PPPP PPP PPP PPPP PPP P + Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP 385 Query: 389 P 387 P Sbjct: 386 P 386 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX--PPXP---PPPPPXXPRXPXPPXPXXP 421 P P PP PPPP PP PPPPP R PP P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP---PPXPXXXXKXP 387 P PP P PPPP PPPPP PPPP PP P P Sbjct: 297 PPPPSRGAP---PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP 348 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PPPP PPPP P P PP+ Sbjct: 308 PPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPV 358 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP PPPPPP P PP P P Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP 385 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP PPPPPP R P PPP Sbjct: 349 PSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/47 (48%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPP----XPPPPPPXXPXXXXPPP-PXXP 420 P PP+ PP P PPP PP PPPPPP P PPP P P Sbjct: 367 PPPPVGGPPPP-PPPIEGRPPSSLGNPPPPPP--PGRGAPPPGPMIP 410 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 7/67 (10%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP-----PPP--XXXPXPXPP 437 P P P P PP PPP PPP PPP P P PP Sbjct: 309 PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 368 Query: 436 XPXXXPP 416 P PP Sbjct: 369 PPVGGPP 375 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP-----PPPPXXPXXXXPPPPXXPP 417 P PP P PP PP PP PPPP PPPP PP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPP--PP 331 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPPP PP P P PP PP Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPP-----PPPXXPRXPXPPXP---XXPPP 415 P PP PPPP PPP PPP P PP P PPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 376 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXX--PXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 PP P PPPP P PPPPP P P PP P P Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = -1 Query: 530 LXPPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPP-----XXPPPXPXXXXKXP 387 + PPP P PPP PPPPP PPPP PPP P + P Sbjct: 285 IQPPPPPSRGAAPPPPSRGAPPPPPSR--GSAPPPPPARMGTAPPPPPPSRSSQRP 338 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPP----PP---XXPXPPPPPPXXXPXPXPPXP 431 P P PP P PP PP P PPPPP P P P P Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P PPP PPPPPP P PP P Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P PPPP PPPP PPP P P P Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAP---PPPSMGMAPPPVGGAAPP 364 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP PPPP PPPPP P PP Sbjct: 287 PPPPPSRGA---APPPPSRGAPPPPPSRGSAPPPPP 319 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P PP P PPPP PPP P Sbjct: 375 PPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX-PPXPPPPPPXXPRXPXPPXP----XXPPP 415 P P PPPP PPPPP P PP P PPP Sbjct: 291 PSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX--PPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PPPP P P P PPP Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP--PPPSMGMAPPP 357 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = -2 Query: 577 PXXXPXXXXPXPXXP----PXXXXXXPXPPPPXXPXPPPPPP 464 P P P P P P P PPPP PPP P Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 5/36 (13%) Frame = -2 Query: 505 PPPPXXPXPPPP-----PPXXXPXPXPPXPXXXPPL 413 PPPP PPP PP P P P PP+ Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPI 381 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 36.7 bits (81), Expect(2) = 7e-05 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPP 414 PPPPPP P PPP PPP Sbjct: 756 PPPPPPAVPGEGARPPPPPPPP 777 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 8/49 (16%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP------PP--PPXXPXXXXPPPPXXPPP 414 P PPP PPPP P PP P PPPP PPP Sbjct: 680 PSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPP 728 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 PP PPP P P P PPPPPP Sbjct: 755 PP--PPPPPAVPGEGARPPPPPPPP 777 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPP------PPPXXPXXXXP--PPPXXPPPXP 408 P PP P PPPP P PP P PPP PPP P Sbjct: 680 PSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 480 PPPPPPXXPRXPXPPXPXXPPP 415 PPPPPP P P P PPP Sbjct: 756 PPPPPPAVPGEGARPPPPPPPP 777 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPP 418 P PPPPP PP P PP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 4/20 (20%) Frame = -2 Query: 511 PXPPPPXXP----XPPPPPP 464 P PPPP P PPPPPP Sbjct: 756 PPPPPPAVPGEGARPPPPPP 775 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXP 453 PP P PP PPPPP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP P PP P PPP Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPP 728 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -3 Query: 489 PPXPPPP--PPXXPRXPXPPXP 430 PP PPPP P R P PP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 27.9 bits (59), Expect(2) = 7e-05 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP 468 PPL PP P P PPPP Sbjct: 707 PPLSAPPLSSTLGPPPPAPPPPP 729 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 45.2 bits (102), Expect = 7e-05 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 PP PP P PPP PP PPP P P PP Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P PP P PP PPP P P P PPP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXP-PLXPPPXPXPPPPXXPPX-PPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP P PP PP PP PPP P PPP PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEP---PTPPPTDPPTQP 1059 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PP P PPP P P PPP P P P P P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEP--PTPPPTEPPTPPPTDPPTQP 1059 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGGG GG GG G Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAG 831 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPP P P PP P P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PP P PPP PP P P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTP 1050 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG--XRGGXG 543 G G GGG G GGG G G GG G GG GG G Sbjct: 803 GMGMSGGGSMGAHG--GGGMAGGGSSMGGAGSTVHGGLDMDGGGG 845 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 422 GXXGXGGXGXRGXXGGGG-GGXGGXXGGGG 508 G G G G G GGGG G G GG G Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAG 831 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPR 451 P P PP PPP P PP PP PR Sbjct: 1034 PPPTEPPT------PPPTEPPTPPPTDPPTQPR 1060 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -1 Query: 533 PLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP P PPPP P PPPP PPPP PP Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P PP P PPPP PPPPPP P PP P Sbjct: 298 PPLPPSRDQA-PAPPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/62 (38%), Positives = 26/62 (41%), Gaps = 7/62 (11%) Frame = -1 Query: 542 PXPPLXPPPXPX----PPPPXXPPXP---PPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P PP+ PP PPPP P P PPPPP P P PPP P P Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP--PGRRPPSGKINPPPPPPPAMDKPS 399 Query: 383 FS 378 F+ Sbjct: 400 FT 401 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP-----XPPPPPPXXPXXXXPPPPXXPPP 414 P PPL P PPP PP PPPPP P PPP PPP Sbjct: 331 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP--PPP 376 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPPP PP P PP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -1 Query: 530 LXPPPX----PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 L PPP P P PP PPPP PPPP PP P P Sbjct: 229 LAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNP 280 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPL P P PP P PPPP PP P P PP P P Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 367 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP P PPPP PPPP PP Sbjct: 250 PPPPMRGPTSGGEPPP---PKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 8/60 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP------PPPPPXXPXXXXPPPPXX--PPPXPXXXXKXP 387 P PP P PPP PP PP PP PPPP PPP P + P Sbjct: 270 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 329 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = -1 Query: 536 PPLXPP--PXPXPPPPXX-PPXPPPPPPXXPXXXXPPPP----XXPPPXP 408 PPL P P PPPP PPPPPP PPPP PPP P Sbjct: 298 PPLPPSRDQAPAPPPPLNA--TPPPPPPSRDQVPLPPPPLRGQIAPPPPP 345 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 10/70 (14%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP------PPPPPXXXP----XP 446 P P P P PP PPPP P PPPPP P P Sbjct: 312 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP 371 Query: 445 XPPXPXXXPP 416 PP P PP Sbjct: 372 PPPPPGRRPP 381 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP----PXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P PPPP PPPP P PPPP P P P Sbjct: 319 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPP 374 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPPP PP PPPPP P PPP Sbjct: 2 PPPP--PPPGPPPPPSAPSGPVKPPP 25 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP P P PPPPP P P PPP P F Sbjct: 344 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP--PGRRPPSGKINPPPPPPPAMDKPSF 400 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PPPP PPPPPP R P PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPG--RGPSQRSLAPPP 233 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PPPPP + P PPP Sbjct: 319 PPPPPSRDQVPLPPPPLRGQIAPPPPP-ISKPPTSTRSAPPPP 360 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P PPP PPPP P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -2 Query: 535 PPXXXXXXPXP-PPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 PP P P PPP PPPP PP P PP N P Sbjct: 231 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 281 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXP 440 P PPPP P PPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PPPP PPPP PPPP P Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 9/59 (15%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXP-------PPPPPXXPRXPXPPXP--XXPPPXXXXXXXTPL 385 PP PPPP P PP PP + P PP P PPP PL Sbjct: 272 PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPL 330 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPP 415 P PPPPP P P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPP 414 P PPPPP P P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGG 504 EKK GGGG G G GGGG GG GG Sbjct: 59 EKKSSSGGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 475 GGXGGXXGGGGXGXGGGXRGG 537 GG GG GGGG GGG GG Sbjct: 76 GGGGGFSGGGGGSMGGGGLGG 96 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXX 345 PP PPPP PPPP P PPP P P + F Sbjct: 134 PPKNSSPPPPFG--APPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTST 191 Query: 344 XXXPXP 327 P P Sbjct: 192 NGPPPP 197 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP P PPPP P PPP P PP PPP Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 252 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P PPP P P PP P PPPP P Sbjct: 218 PPPGRGPSQRSLAPPPTGSSRPLPAPP--PGENRPPPPMRGP 257 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP----PPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPP P P PP PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 251 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/73 (27%), Positives = 20/73 (27%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP PPPP PP P PP Sbjct: 233 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKN---APPPPKRGSSNPPPPPTRGPP 289 Query: 415 LXXXXXXNXPFFP 377 P P Sbjct: 290 SNSFTTQGPPLPP 302 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPPP PPPPPP PPP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPP---GRGPSQRSLAPPP 233 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P PPP P PPPP P PP PP PL Sbjct: 250 PPPPMRGPTSGGEPPP--PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 300 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 GG GGGGG GG G GG G GG GG Sbjct: 65 GGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXPXP 327 PPPP PPP PPPP P P S P P P Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 8/47 (17%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPP--------PXXPXXXXPPPPXXPPPXP 408 PPP PPP P PPPP PPPP PP P Sbjct: 133 PPPKNSSPPP--PFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 177 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PP PPP P PP P P PP P Sbjct: 350 PTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 10/50 (20%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXX-------PXPPPP---PPXXXPXPXPPXP 431 P P P PPPP P PPPP PP P PP P Sbjct: 343 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPP 463 P P P P P PPPP P PPPPPP Sbjct: 344 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 8/53 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXPRXPXPP-----XPXXPPP 415 P P P PP P P PPPP P PP P PPP Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = -1 Query: 524 PPPXPXPPPPXX---PPXPPPPPPXXPXXXXPP 435 PPP P PP PP PPPP P P Sbjct: 372 PPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 404 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 9/54 (16%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP--------PP-PPXXXPXPXPPXPXXXPP 416 P PP PPPP PP PP PP P PP P P Sbjct: 265 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 318 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PPP PP P P PP Sbjct: 454 PRPASSSRGAPPPVPPSRGPPPPPP 478 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -1 Query: 533 PLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP P PPPP P PPPP PPPP PP Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P PP P PPPP PPPPPP P PP P Sbjct: 210 PPLPPSRDQA-PAPPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/62 (38%), Positives = 26/62 (41%), Gaps = 7/62 (11%) Frame = -1 Query: 542 PXPPLXPPPXPX----PPPPXXPPXP---PPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P PP+ PP PPPP P P PPPPP P P PPP P P Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP--PGRRPPSGKINPPPPPPPAMDKPS 311 Query: 383 FS 378 F+ Sbjct: 312 FT 313 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP-----XPPPPPPXXPXXXXPPPPXXPPP 414 P PPL P PPP PP PPPPP P PPP PPP Sbjct: 243 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP--PPP 288 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPPP PP P PP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -1 Query: 530 LXPPPX----PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 L PPP P P PP PPPP PPPP PP P P Sbjct: 141 LAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNP 192 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPL P P PP P PPPP PP P P PP P P Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 279 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPP P PPPP PPPP PP Sbjct: 162 PPPPMRGPTSGGEPPP---PKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 8/60 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP------PPPPPXXPXXXXPPPPXX--PPPXPXXXXKXP 387 P PP P PPP PP PP PP PPPP PPP P + P Sbjct: 182 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 241 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = -1 Query: 536 PPLXPP--PXPXPPPPXX-PPXPPPPPPXXPXXXXPPPP----XXPPPXP 408 PPL P P PPPP PPPPPP PPPP PPP P Sbjct: 210 PPLPPSRDQAPAPPPPLNA--TPPPPPPSRDQVPLPPPPLRGQIAPPPPP 257 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 10/70 (14%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP------PPPPPXXXP----XP 446 P P P P PP PPPP P PPPPP P P Sbjct: 224 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP 283 Query: 445 XPPXPXXXPP 416 PP P PP Sbjct: 284 PPPPPGRRPP 293 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP----PXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P PPPP PPPP P PPPP P P P Sbjct: 231 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPP 286 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP P P PPPPP P P PPP P F Sbjct: 256 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP--PGRRPPSGKINPPPPPPPAMDKPSF 312 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PPPP PPPPPP R P PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPG--RGPSQRSLAPPP 145 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PPPPP + P PPP Sbjct: 231 PPPPPSRDQVPLPPPPLRGQIAPPPPP-ISKPPTSTRSAPPPP 272 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -2 Query: 535 PPXXXXXXPXP-PPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 PP P P PPP PPPP PP P PP N P Sbjct: 143 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPP 193 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PPPP PPPP PPPP P Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 9/59 (15%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXP-------PPPPPXXPRXPXPPXP--XXPPPXXXXXXXTPL 385 PP PPPP P PP PP + P PP P PPP PL Sbjct: 184 PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPL 242 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXX 345 PP PPPP PPPP P PPP P P + F Sbjct: 46 PPKNSSPPPPFG--APPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTST 103 Query: 344 XXXPXP 327 P P Sbjct: 104 NGPPPP 109 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP P PPPP P PPP P PP PPP Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 164 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P PPP P P PP P PPPP P Sbjct: 130 PPPGRGPSQRSLAPPPTGSSRPLPAPP--PGENRPPPPMRGP 169 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP----PPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPP P P PP PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 163 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/73 (27%), Positives = 20/73 (27%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP PPPP PP P PP Sbjct: 145 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKN---APPPPKRGSSNPPPPPTRGPP 201 Query: 415 LXXXXXXNXPFFP 377 P P Sbjct: 202 SNSFTTQGPPLPP 214 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPPP PPPPPP PPP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPP---GRGPSQRSLAPPP 145 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P PPP P PPPP P PP PP PL Sbjct: 162 PPPPMRGPTSGGEPPP--PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 212 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXPXP 327 PPPP PPP PPPP P P S P P P Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 8/47 (17%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPP--------PXXPXXXXPPPPXXPPPXP 408 PPP PPP P PPPP PPPP PP P Sbjct: 45 PPPKNSSPPP--PFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 89 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PP PPP P PP P P PP P Sbjct: 262 PTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 10/50 (20%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXX-------PXPPPP---PPXXXPXPXPPXP 431 P P P PPPP P PPPP PP P PP P Sbjct: 255 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPP 463 P P P P P PPPP P PPPPPP Sbjct: 256 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 8/53 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXPRXPXPP-----XPXXPPP 415 P P P PP P P PPPP P PP P PPP Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = -1 Query: 524 PPPXPXPPPPXX---PPXPPPPPPXXPXXXXPP 435 PPP P PP PP PPPP P P Sbjct: 284 PPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 316 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 9/54 (16%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP--------PP-PPXXXPXPXPPXPXXXPP 416 P PP PPPP PP PP PP P PP P P Sbjct: 177 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 230 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PPP PP P P PP Sbjct: 366 PRPASSSRGAPPPVPPSRGPPPPPP 390 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P PPP P PP PP PPPP PP Sbjct: 168 PAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PP PP P PP P P P PP P Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PPPP P PP PP P PP P P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 8/46 (17%) Frame = -1 Query: 521 PPXPXPPP------PXXPPXPPPP--PPXXPXXXXPPPPXXPPPXP 408 PP P PP P PP PPPP P P PP PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PP PP P P P PP PPP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPP PP P P P P PP+ Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPV 210 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPP-XPXXXXKXPF 384 P PP PP P PP PPP P PF Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPF 195 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P P P PP P PP P PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 9/59 (15%) Frame = -1 Query: 542 PXPPLXPPPXPX------PPPPXXPPXPPPPP--PXXPXXXXPPPPXXP-PPXPXXXXK 393 P PP PP P PPPP P PP PP P P P PP P PP P K Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQPSNK 1294 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 530 LXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 + PPP PP PP PPPPP P P PP PPP Sbjct: 1234 MPPPPPAMPPDGPPKFMGLPPPPPGMRP--MPPQPPFMPPP 1272 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPP--PXXPR--XPXPPXPXXPP 418 P P PPPP P PP PP P PR P PP P PP Sbjct: 1242 PPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP-----PPXXPXXXXPPPPXXPPPXP 408 PP P P PP PPPP PP P PPPP PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPP--FMPPPPRMQPPGP 1280 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 8/38 (21%) Frame = -3 Query: 507 PPPPXXPPX--------PPPPPPXXPRXPXPPXPXXPP 418 PPPP PP PPPPP P P PP PP Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPP-----PPPXXXPXPXPPXPXXXPP 416 P P P PPP P PP PPP P PP P PP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPP 1271 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPP-PPXXPXPP---PPPPXXXPXPXPPXP 431 P P PP P PP PP P PP PP P P P P P Sbjct: 1239 PAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPP----PPXXPXPPPPPPXXXPXPXP 440 P P P P PP P PP PP P PP P P P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PP PP P PP P P PP P P Sbjct: 1237 PPPAMPPDGPPKFMGLPPP-PPGMRPMPPQPPFMPPPPRMQPPGP 1280 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PPPP P PP PP PPPP P P P Sbjct: 1225 PPMGHHMMNMPPPP--PAMPPDGPPKF-MGLPPPPPGMRPMPPQPPFMPP 1271 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXPPP 415 P PP P PP PP P P+ P PP P PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPP 1278 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 512 PXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP PPPPP P P PPP P P Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPP 1264 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXX--PPPPXXPPPXP 408 P PP PPP P PPP PPPP PP P Sbjct: 1201 PNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGP 1246 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = -3 Query: 549 PXPXXPPXXXXXXX--PPPPXXPPXPPPPPPXXPR 451 P P PP PP P PP PP P P R Sbjct: 1261 PMPPQPPFMPPPPRMQPPGPPGPPGPPGPQPSNKR 1295 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG G G GGG GG GG G G GGG GG G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = +1 Query: 382 KKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 + G G GGG G G G GGGGG GG G G GGG Sbjct: 34 RPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG 498 G GG GGGG GG GGG GG G Sbjct: 54 GGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGG GG GGG GG G G Sbjct: 43 GRGG-GRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 441 GXGXGXXXGG--GGGGXGXXGGGGXGXXXXXXGGXXG 545 G G G GG GGG G GGGG G GG G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGG-GFKSPRGGGRGG 76 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP-PPXXPXXXXPPPP 429 PPP PPPP PP PPPP P P P PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/32 (53%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 507 PPPPXXPPXPP-PPPPXXPRXPXPPXPXXPPP 415 PPPP PP P PP P P+ P PP P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP PPP PP P P P PP P P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTP---APPAP 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 PPPP PP PPPP P P P P P Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -1 Query: 506 PPPPXXPPXPP-PPPPXXPXXXXPPPPXXP-PPXPXXXXKXP 387 PPPP PP P PP P P PP P P PP P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKP 136 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P PPPP P PP P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PP PP P PP PP P P P P P Sbjct: 102 PPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKP 136 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP 439 P P PP PP P P P PP P P P P Sbjct: 96 PPPATPPPPTM---PPTPPPPQTPAPPGPDTPAPPAP 129 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXX-PXPPPPXXPXPPPP 470 P P P PP P PP P P PP P Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P P PPPP P P PPPP PPP P Sbjct: 888 PKTTTAPPTTPTTPKPTTPA-PPPPLPLAPE---PPPPLPPPPPP 928 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 19/71 (26%) Frame = -1 Query: 542 PXPPLXPPPXPX----PPPPXXP--------PXPPPP----PPXXPXXXXPPPPXX---P 420 P PPL PPP P P P P P PPPP PP P PPPP P Sbjct: 918 PPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPP 977 Query: 419 PPXPXXXXKXP 387 PP P P Sbjct: 978 PPPPVQTTTAP 988 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = -1 Query: 542 PXPPLX--PPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP PPP P PPP PP PPPPPP PP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 16/68 (23%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP-----PXXP---------XXXXPPPP--XXPPPX 411 P P PPP P P P P PPPPP P P PPPP PPP Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPI 962 Query: 410 PXXXXKXP 387 P P Sbjct: 963 PATQVPPP 970 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPPP PP P P P PP P PPP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PP P PPPP P PPP P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PP P P PPP PP P P P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXP 421 P PP PPPP P PPPPP P PP P Sbjct: 954 PTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = -2 Query: 505 PPPPXXPXP----PPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPPP P P PP P PP+ Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPI 929 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PP PPP P P P P PPP Sbjct: 937 PTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPP 979 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 PP P PP P PPPP P P P P P L Sbjct: 951 PPPPTSALP-PPIPATQVPPPPLPPLPPPPPPVQTTTAPTL 990 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P PP PPP PPPPP P P P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPASCMPTHEGTSNGACC 1008 Query: 385 FFPXXF 368 FFP + Sbjct: 1009 FFPFTY 1014 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P PP PPPP PPPPP R P P Sbjct: 906 PAPPPPLPLAPEPPPPLP---PPPPPIQTTRPTVPTTP 940 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXP--RXPXPPXPXXPPPXXXXXXXTP 388 P P PPP P PPPP PP P + P P P TP Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTP 951 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P P P PP PP PP P P PP Sbjct: 934 PTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G G G G G GGG GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G G GGG G GGG G G Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG G G GGGGGG G G G GG G G G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG G G GGGGGG G G G G G G G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G GGGG G G G G G Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G G G G G G GGG G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G GGGGGG G G G GG G G Sbjct: 41 GGGGGGGGGG---GGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GGGGGG G GG G G G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G G GGG G G G Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/78 (35%), Positives = 30/78 (38%), Gaps = 6/78 (7%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G +K+ G GGG GGG GG GGG GG GGG Sbjct: 106 GMGPMAPEGGPSEGGLMQKQFIEGGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGS 165 Query: 508 XG------XGGGXRGGXG 543 G GGG GG G Sbjct: 166 MGGGMMSMAGGGMGGGMG 183 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG G GGG G GGG GG GGG G G GG GG Sbjct: 152 GMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +1 Query: 409 GXGGGXXGGG-GXXXXGXXGGG--GGGXGGXXGGG-GXGXGGGXRGG 537 G GGG GG G G GGG GGG GGG G G GGG GG Sbjct: 143 GMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGG 189 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 GGG GGG G GG GGG GG GGG G GGG G Sbjct: 162 GGGSMGGGMMSMAG--GGMGGGMGGGMGGGMEGGMGGGMMEG 201 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG GG G G G GGG G GGG G G GG Sbjct: 185 GMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGG 230 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGG--XGXXXXXXGGXXGXG 551 GG GG G G GG GGG G GGG G GG G G Sbjct: 135 GGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGG 181 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = +1 Query: 415 GGGXXGG-GGXXXXGXXGGGGG----GXGGXXGGGGXGXGGGXRGGXG 543 GGG GG GG G GG GG G G GG GGG GG G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMG 222 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGG 505 GGG G G G GGG GGG G GGG Sbjct: 167 GGGMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGG--GGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G GGG GGG GG G G GG GG G Sbjct: 189 GMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGM-EDGGKEGGMG 236 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGG G G GG G GGG G GG Sbjct: 209 GGGMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGDSNGGG 249 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G G GGG G GGG G GG G G G G Sbjct: 158 GGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGG 216 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG--GGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G G GGG GGG GGG G GG G G Sbjct: 146 GGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMG---GGMGGGMGGG 189 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GG G G +G GGG GG GGG GG G Sbjct: 192 GGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEG 233 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 +G G GG GGG GG GG GG G GGG Sbjct: 203 QGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGDSNGGG 249 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG GG GGGG G GGG RGG G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGGGG GG GGGG G GGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +2 Query: 422 GXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 G G GG G G GGGGGG GG GGGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GG GGGG G GGGGGG GG GGGG G Sbjct: 337 GGSGRGGGGGGGGG--GGGGGGGGGRGGGGGFSSRG 370 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G G GGGG G GGGGGG GG G G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGG 506 RGG G GG G G GGGGGG G GGGG Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGG-GRGGGGG 365 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG GGGG G GGG GG G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GGGGGG G GGGG G GG G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 RG G GGGG GG GGGG GG Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +1 Query: 355 GXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G + + G G GGG GGGG GGGG G GG G G Sbjct: 327 GYRIRVEFPRGGSGRGGGGGGGGGGGGGG-------GGGGRGGGGGFSSRGRG 372 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 471 GGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G GGGG G GG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G G G GGGG G G G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGG G GGGGG GG GG G GG GG Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGG 40 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG G GG G G GGG G G GG GG GG Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGG 45 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G G GG GG G RGG G Sbjct: 17 GGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDG 61 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GGG G G GGG G G G G G Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDG 39 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP------PPPPPXXP------XXXXPPPPXXPPPXP 408 P PP+ PPP PP PP P PPPPP P PP PPP P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLX--PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPL P P PPPP P P P PPPP PPP Sbjct: 299 PAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPP--PPP 341 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 10/55 (18%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPP-PXXP----PXPPPPPPXXPRXP-----XPPXPXXPPP 415 P P P PPP P P P PPPPPP P P PP PPP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPP 337 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P P PPPP P P PP Sbjct: 286 PMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPP 330 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 9/49 (18%) Frame = -1 Query: 533 PLXPPPXPXPP---------PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP P PP PP PPPPPP P P P Sbjct: 309 PSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSP 357 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-----PXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P L PPP P P P P P PP P P PPP P Sbjct: 329 PPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPPP 378 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = -3 Query: 549 PXPXXP-PXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PPPP PP P P P P PP Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP---PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ PP P PP PP P PP PPP Sbjct: 246 PPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPP 291 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 7/57 (12%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP-------PXXXPXPXPPXPXXXPP 416 P P P P PP P PPPPP P P P PP P Sbjct: 309 PSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAP 365 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 6/51 (11%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP------PPXXXPXPXPPXP 431 P P PP P PPPP P P PP P PP P Sbjct: 291 PAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = -2 Query: 496 PXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXPFXXXXSXXPXXX 317 P P PPP P P PP P P P P L P P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPS 342 Query: 316 XXFFXPP 296 F+ P Sbjct: 343 EDFYSMP 349 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PP PPPPPP P P P Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSP 357 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXPP 418 PP PP PPP P P PP Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPP 268 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPP 462 PPP PPPP PP PPPPPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 PPP PP PPPPPP P P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 PPL PP P PPPP PP P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP PP PPPPPP P PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPP----PPPGAKKPDDP 101 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P PPP P PPPP PPPPP Sbjct: 73 PPPLCAPPPPPPPPPP-----PPPPP 93 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP 474 P PP PPP P PPP P P Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP P PPPP PPP P K P Sbjct: 73 PPPLCAPP---PPPPPPPPPPPPPGAKKP 98 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXP 431 PPPP P PPPPPP P P Sbjct: 79 PPPP--PPPPPPPPPPPGAKKPDDP 101 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPP 462 PPP PPPP PP PPPPPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 PPP PP PPPPPP P P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 PPL PP P PPPP PP P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP PP PPPPPP P PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPP----PPPGAKKPDDP 302 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P PPP P PPPP PPPPP Sbjct: 274 PPPLCAPPPPPPPPPP-----PPPPP 294 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP 474 P PP PPP P PPP P P Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP P PPPP PPP P K P Sbjct: 274 PPPLCAPP---PPPPPPPPPPPPPGAKKP 299 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXP 431 PPPP P PPPPPP P P Sbjct: 280 PPPP--PPPPPPPPPPPGAKKPDDP 302 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P P PPPP P PPPPPP P P P P + + P Sbjct: 411 PTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSP 465 Score = 34.7 bits (76), Expect(2) = 0.001 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPP PPP P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPP--PPPQPTTALPDP 450 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PPPP P P P P PP P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPPDQP 469 Score = 25.8 bits (54), Expect(2) = 0.001 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 524 PPPXPXPPPP 495 PPP P PPPP Sbjct: 373 PPPPPQPPPP 382 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG G GGGGGG GG GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSG 60 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGG G G GGG GG GGGG G GGG G Sbjct: 25 GGGGHG--GGHGYGGGPNGGGGGGGGGGGGGGDEDDSG 60 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G GGG GGG G GGGGGG GG G Sbjct: 28 GHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSG 60 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGGGG G G G + G Sbjct: 34 GYGGGPNGGGG---GGGGGGGGGGDEDDSGKNGKEYSGKNKWNNG 75 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG 489 G GG G GG G GGGGGG GG Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GGGG G G GGG GG G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 42.3 bits (95), Expect = 5e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXP 453 PPP P PPP P PPPPPP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPPPPP PPPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPPPP PPPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PPPPP P PP P PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 35.9 bits (79), Expect = 0.044 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXP 408 PPPPPP P P PP PP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PPP PPPP PP P PP Sbjct: 582 PIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = -2 Query: 511 PXPPPPXX--PXPPPPPPXXXP 452 P PPPP P PPPPPP P Sbjct: 85 PPPPPPASNVPAPPPPPPVMPP 106 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP PPP P P PP PP PP Sbjct: 82 PPPPPPPPPASNVPAP--PPPPPVMPP 106 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPP 476 P P P PP P PPPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPP--XXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP PPPP + PP P PP Sbjct: 570 PPPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 42.3 bits (95), Expect = 5e-04 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXP 453 + PP P PPPP PP PPPP P P Sbjct: 1305 IQPPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 42.3 bits (95), Expect = 5e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXP 430 PP PP PPPPPP P P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP 465 PP PPP P PPPP PP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPP 429 PP PP PPPPPP P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 37.9 bits (84), Expect = 0.011 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXP 446 PPPP P PPPPPP P P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP 468 P P PPP P PPPP PP PP P Sbjct: 1308 PESPPPPPPPPPPPPP--PPLPPTP 1330 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP 439 P P PP PPPPPP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXP 421 P PPPPPP P P PP P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPP 414 P PPPP P PPPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPP 415 P PPPP P P PP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPP 470 P PP P PPPP P PP P Sbjct: 1308 PESPPPPPPPPPPPPPP--PLPPTP 1330 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 42.3 bits (95), Expect = 5e-04 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 8/80 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP--------PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP PP PP PPPP PPPP P P P Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGM--RGMPPPPMGMYPPPRGFPPPP 486 Query: 386 FFSXXXFXXXPXXXXXXPXP 327 F F P P P Sbjct: 487 FGPPPPFYRGPPPPRGMPPP 506 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPP PP P PPP P PPPP PP P Sbjct: 469 PP--PPMGMYPPPRGFPPPPFGPPP--PFYRGPPPPRGMPPPP 507 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Frame = -1 Query: 542 PXPPLX--PPPXPXPPPPXXPPXP----PPPPPXXPXXXXPPPPXXPPP 414 P PP+ PPP PPPP PP P PPPP P P PP Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPP PP P PPP R P PP PPP Sbjct: 477 PPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PP P P P PP PPP Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPP 499 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPP--PPPPXXXPXP---XPPXPXXXPP 416 P P PP P PP P P PPPP P P PP P PP Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPP 505 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PP PPPP P P P PP Sbjct: 431 PQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPP 490 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P P P PPPP PP P P Sbjct: 483 PPPPFGPPP-PFYRGPPPPRGMPPPPRQRMPSQGPPQVHYPSQDP 526 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = -1 Query: 506 PPPPXXP-PXPPPPPPXXPXXXXPP--PPXXPPP 414 PPPP P P PP P PP PP PPP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPP 461 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP P PP PPPP P PP Sbjct: 479 PRGFPPPPFGPPPPFYRGPPPPRGM----PPPPRQRMPSQGPP 517 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -1 Query: 530 LXPPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 L PPP P PP PP PPPP P PPPP P Sbjct: 177 LAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPP 417 P + PP P PP PP PP PPP P PPP PP Sbjct: 174 PGILAPP-PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP PPP PP P P P PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPP 210 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PP PP P P PP PPP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPP 211 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXP 430 P PP PPP P PPPP P P PP P Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPP 436 P PP PP PP P PP P P PP Sbjct: 180 PPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 542 PXPP--LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PP L PPP P P PP P PP P PP Sbjct: 181 PAPPGVLAPPPAP---PGVLPPPPAPPGALIPPPPAPP 215 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP P PP P PP PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP P PP PP P P P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPP--PXX---PPPXP 408 PP PP PPP P PPP P PPP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = -1 Query: 506 PPPPXXPPXPPPPPP-XXPXXXXPPPPXXPPP 414 PP P PPP PP P PP PPP Sbjct: 180 PPAPPGVLAPPPAPPGVLPPPPAPPGALIPPP 211 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P PP PPPP P PPPP P Sbjct: 184 PGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP---XXPPPXPXXXXK 393 P+ PP P PP P P PP P P PP P PPP P K Sbjct: 769 PVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVARK 818 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP-PPPXXPPPXP 408 P PPL P P PP P P P PPP P P P P P P Sbjct: 749 PAPPLPPKVTPKPPAP--PQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXP 408 PP P PP P PP P PPP P PP P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMP 781 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPP---PPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPX 351 PP P PP P P PP P P PP P P P PF + P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPP---APAPFSAAPHLPPAPN 804 Query: 350 XXXXXPXP 327 P P Sbjct: 805 ISAEPPPP 812 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P PP P PP P+ P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIP 778 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPP--XXPXPPP--P-PPXXXPXPXPPXP 431 P PP P PP P P PPP P PP P PP P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAP 790 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PP P PP PP P P P P P P P F Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAP-VPPPCAPIPPMPCSAPLPPAPAPF 793 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 3/63 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP---XX 424 P P P P PP P P PP P P PP P Sbjct: 749 PAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAE 808 Query: 423 PPP 415 PPP Sbjct: 809 PPP 811 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPP--PPXXPPPXP 408 P P PP PP PP P PP P PP P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAP 776 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPP-XPPPPPPXXPXXXXPPPPXXPPP 414 P PP P P PP P PP P PP P P P P Sbjct: 752 PLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Score = 29.9 bits (64), Expect(2) = 0.41 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = -3 Query: 549 PXPXXP-PXXXXXXXPPPPXXPPXPPPPPP 463 P P P P PP P PPPPPP Sbjct: 785 PLPPAPAPFSAAPHLPPAPNISAEPPPPPP 814 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/61 (27%), Positives = 17/61 (27%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXP 419 P P P P P P P P P PP P P PP P Sbjct: 759 PKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVARK 818 Query: 418 P 416 P Sbjct: 819 P 819 Score = 21.4 bits (43), Expect(2) = 0.41 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -3 Query: 477 PPPPPXXPRXP 445 PPPPP R P Sbjct: 849 PPPPPPVARKP 859 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP----PPXXPXXXXPPPPXXP--PPXPXXXXK 393 P PP P P P PP P PP PP P PP P PP P P PP P K Sbjct: 186 PTPPTPPAP-PSPPIPTAPPTPPMPETPLPPGSP--HIPPAPLHPHIPPAPPNPSK 238 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P P PP P PP PP PP P PP P Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP----PPXXPXXXXPPPPXXP--PPXP 408 PP P P P PP P P PP PP P P PP P PP P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAP 224 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXP--PPXP 408 P P P P PP P P PP P PP P PP P P PP P Sbjct: 306 PSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAP 354 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP-PPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P PP P P PP PP P PP P Sbjct: 259 PFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPP 301 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PP P P P PP P P PP P PP Sbjct: 257 PNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPL--APPNPYIPP 298 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 7/79 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPP----PPPPXXPXXXXPPPPXXP--PPXPXXXXKXPF 384 P PP+ P P P P PP P PP P P PP P P PP P P Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPN 302 Query: 383 FSXXXFXXXPXXXXXXPXP 327 P P P Sbjct: 303 LFIPSAPPNPHIPPAPPNP 321 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPP-PXXPRXPXPPXPXXPP 418 P P PP P P P PP PP P P P PP P PP Sbjct: 310 PNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIP--PAPPNPSIPP 352 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PL P PP P P PP PP P PP P P Sbjct: 209 PETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLP 253 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PP PP PP P PP P P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPP-------PPPPXXPRXPXPPXPXXPP 418 P PP PP P PP PP PP P P P PP P PP Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIP--PAPPNPSIPP 343 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPP-PXXPRXPXPPXPXXPP 418 P PP PP P PP PP P P P P P PP Sbjct: 248 PETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPP 292 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-PPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PP PP P P P PP P P P P PP TP Sbjct: 189 PTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATP 243 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP-PPXXXXXXXTPL 385 P P P PP P P PP P P P PP P P PP PL Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAP--PTPPMPETPLPPGSPHIPPAPL 225 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 11/56 (19%) Frame = -1 Query: 542 PXPPLXPPPXPX------PPPPXXPPXPPPP-----PPXXPXXXXPPPPXXPPPXP 408 P P PP P PP P PP PP P PP PP P PP P Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP 346 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P P P P PP P P PP P P Sbjct: 194 PPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLP 253 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PL P P PP P P PP P P P P PP P Sbjct: 221 PPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASP 266 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPP-PXXPRXPXPPXPXXPP 418 P P P P PP P P P PP PP P P PP P PP Sbjct: 277 PSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIP--TAPPNPSIPP 334 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPP-----PXXPPXP--PPPPPXXPXXXXPPPPXXPPPXP 408 P PL PP P P P P PP P PP PP PP P PP P Sbjct: 285 PSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPP 337 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP-----PPXXPXXXXPPPPXXPPP 414 P PP P P P P PP PP P P P P PP P P Sbjct: 212 PLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNP 259 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXP--PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP P PP P PP PP PP PP P Sbjct: 318 PPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXP-PPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P P PP P P PP PP Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPP 222 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP----PPXXPXXXXPPP---PXXPPPXPXXXXKXP 387 P P PP P P P PP P PP P PP P PP P P Sbjct: 224 PLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAP 282 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P + P P PP PP PP P PP P Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPP 198 Score = 31.9 bits (69), Expect = 0.72 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 13/63 (20%) Frame = -1 Query: 536 PPLXPPPX-----PXPPPPXXPPXPPPP----PPXXPXXXXPPPPXXP----PPXPXXXX 396 PP P P P PP P P P P PP P PP P P PP P Sbjct: 230 PPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPL 289 Query: 395 KXP 387 P Sbjct: 290 APP 292 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PP P P P P P P P P P PP Sbjct: 231 PAPPNPSKAIATPNPPMPETPLPPATPNPFIP--PASPNPSIPP 272 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPP 466 P P PP PP P P PP PP Sbjct: 328 PNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 31.1 bits (67), Expect = 1.3 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 3/108 (2%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPX--PXXP-PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXX 425 P P P P P P P P PP P P PP P P P P P Sbjct: 212 PLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIP-PASPNPSI 270 Query: 424 XPPLXXXXXXNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXP 281 P + P P L P P PP P P Sbjct: 271 PP---APPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIP 315 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 7/66 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-------XPP 436 P P P P PP P PP PP P P P PP Sbjct: 251 PLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPP 310 Query: 435 XPXXPP 418 P PP Sbjct: 311 NPHIPP 316 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P P P PP P P P PP P P P Sbjct: 306 PSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIP-PAPPNPSIPPAP 354 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P P P PP P PP P P PP P Sbjct: 182 PSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 28.7 bits (61), Expect = 6.7 Identities = 25/95 (26%), Positives = 25/95 (26%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P P P P P P PP P P PP P PL P Sbjct: 246 PMPETPLPPATPNPFIPPASPNPSIPPAPPNP-----SIPAPPNPSI--PLAPPNPYIPP 298 Query: 385 FFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXP 281 P F P P PP P P Sbjct: 299 APPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIP 333 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PP PP PP P P PP Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIP-PAPP 355 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P+ PP P PPPP PP PPPPP Sbjct: 59 PTVPI-PPTLPPPPPPPPPPLPPPPP 83 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P P P PPPP PP P PPPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP PPP PPPP PP PPPPP Sbjct: 62 PIPPTLPPP---PPPP--PPPLPPPPP 83 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPP 436 P PP PP PPPPPP P P PP Sbjct: 62 PIPPTLPPPPPPPPPPLP--PPPP 83 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P PPPPPP PPPP PPP Sbjct: 59 PTVPIPPTLPPPPPP-------PPPPLPPPP 82 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXP 440 P PP P PPPPPP P P P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 35.5 bits (78), Expect = 0.058 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPP 436 P P P PPPPPP P P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPPPP PPPP PPP P Sbjct: 59 PTVPIPPTLPPPPP-------PPPPPLPPPPP 83 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXP 446 P PP P PPPPPP P P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P PP P PPPP PPPPP Sbjct: 59 PTVPIPPTLPPPPPPPPPP---LPPPPP 83 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG---GGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G GG GGG G GG G G GGG RGG G Sbjct: 388 GVSGMRRGRGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRG 435 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG G GG GGG G G GGG G G G RGG Sbjct: 397 GGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGG 436 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 +G G GG GGG GGG G GG G GG Sbjct: 396 RGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGG 436 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXG 498 +G G GGG G G GGG GG GG G Sbjct: 402 RGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPXPPXP 430 P PP P P PR P PP P Sbjct: 153 PQMPPQMAPGTPLMPRIPTPPLP 175 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGX-GXXGGGGXGXXXXXXGGXXG 545 RGG G GG G GGG G G GGG G GG G Sbjct: 396 RGGYR-GRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGG 505 GG G GG G GG GGG GG GG Sbjct: 406 GGYRGRGG-GRGYYRGGRGGGRGGGGRGG 433 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P+ PP P PPPP PP PPPPP Sbjct: 283 PTVPI-PPTLPPPPPPPPPPLPPPPP 307 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P P P PPPP PP P PPPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP PPP PPPP PP PPPPP Sbjct: 286 PIPPTLPPP---PPPP--PPPLPPPPP 307 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPP 436 P PP PP PPPPPP P P PP Sbjct: 286 PIPPTLPPPPPPPPPPLP--PPPP 307 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P PPPPPP PPPP PPP Sbjct: 283 PTVPIPPTLPPPPPP-------PPPPLPPPP 306 Score = 36.3 bits (80), Expect = 0.033 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXP 440 P PP P PPPPPP P P P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 35.5 bits (78), Expect = 0.058 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPP 436 P P P PPPPPP P P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPPPP PPPP PPP P Sbjct: 283 PTVPIPPTLPPPPP-------PPPPPLPPPPP 307 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXP 446 P PP P PPPPPP P P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P PP P PPPP PPPPP Sbjct: 283 PTVPIPPTLPPPPPPPPPP---LPPPPP 307 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P P PPP P PPP P PPP Sbjct: 427 PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 474 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P P PPP Sbjct: 437 PHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 484 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P P PPP Sbjct: 447 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 494 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P P PPP P PPP P PPP Sbjct: 447 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 494 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P P PPP P PPP P PPP Sbjct: 467 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPP 514 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P P PPP Sbjct: 487 PHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P P PPP Sbjct: 507 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P P PPP P PPP P PPP Sbjct: 507 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P P PPP P PPP P PPP Sbjct: 517 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPP 564 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P P PPP Sbjct: 527 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPP 574 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P P PPP Sbjct: 547 PHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPP 594 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P PP P P PP P P PPP P PPP P PPP Sbjct: 437 PHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 484 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P P PPP Sbjct: 427 PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 474 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P PP PPP P P PPP PR P P P P PPP Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P + PP P P PP P P PPP P PPP P PPP Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPP P P PP PPP P PPPP P Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAP 335 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P PPP Sbjct: 457 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPP 504 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP R P P P P PPP Sbjct: 467 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPP 514 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P PPP PR P P P P PPP Sbjct: 477 PHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPP 524 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P PPP P PPP P PPP Sbjct: 477 PHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPP 524 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P PP P P PPP P PPP P PPP Sbjct: 487 PHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P PP PPP P P PPP PR P P P P PPP Sbjct: 497 PHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 544 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P + PP P P PP P P PPP P PPP P PPP Sbjct: 497 PHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 544 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP PR P P P PPP Sbjct: 517 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPP 564 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P P PPP PPP P PPP Sbjct: 527 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPP 574 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P PPP PR P P P P PPP Sbjct: 537 PHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP 584 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P + PP P P PP P PPP P PPP P PPP Sbjct: 537 PHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP 584 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = -1 Query: 533 PLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P PPP P PP P P PPP P PPP P PPP Sbjct: 549 PRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPP 594 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PP P P PPP PR P P P P PPP Sbjct: 407 PHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPP 454 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPP 432 P P + PP P P PP P P PPP P PPP Sbjct: 567 PHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP--PXPXXPPP 415 PP PPP P PPP PR P P P P PPP Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPP 464 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPPXP 408 P P + PP P P PP P P PPP P P P PPP P Sbjct: 577 PHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGP 626 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = -1 Query: 524 PPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 PP P P PP P P PPP P PPP P PPP Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPP 464 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/63 (28%), Positives = 21/63 (33%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFX 363 P P P P PP PP PPP P P PP P + P + + Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYS 359 Query: 362 XXP 354 P Sbjct: 360 RVP 362 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 PP P P PP P PPP P P P P P PP P Sbjct: 563 PPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP--PXPXXPPP 415 PP PPP P P P PR P P P P PPP Sbjct: 373 PPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPP 414 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXP 430 P P PP PPP P P PPP P+ P P P Sbjct: 567 PHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP P PPP P P PPP P P P P Sbjct: 452 PPPGAPHPRVPP-PGAPHPRVPPPGAPHPRVPPP-GAPHPRVPPP 494 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 12/53 (22%) Frame = -1 Query: 536 PPLXPPPXPXPPP--------PXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 PP P PPP P P P PPP P PPP P PPP Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPP 454 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -1 Query: 512 PXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXPPP 414 P PPP P P PP P PPP PPP Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPP 330 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 13/56 (23%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPP--------PPXXPXXXXPPP----PXXPPP 414 P P P PPP P P PPP PP P PPP P PPP Sbjct: 389 PRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPP 444 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-PXPPPPPPXXP--RXPXPPXPXXPPP 415 P P PPP P P PPP R P P P PPP Sbjct: 389 PRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPP 434 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P P + PP P P P PP P PPP P Sbjct: 597 PHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAP 637 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/54 (29%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPX--PPXPXXXPPLXXXXXXNXPFFPXXFFXLXPF 350 PPP P P PP P P PP PP+ P P P+ Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPY 353 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPP--XPXXPPP 415 PP PPP P PPP R P P PPP Sbjct: 583 PPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPP 624 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPPP PPPPP P PPPP PPP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPP--PPP 329 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPPP PPPPP P PP P PPP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPP--PPP 329 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PPP P PPPP P PPPP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 11/48 (22%) Frame = -1 Query: 518 PXPXPPPPXXPPX-------PPPPPPXXPXXXXPPPPXX----PPPXP 408 P P PPPP P PPPPP PPPP PPP P Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP P P PP P PPPPPP Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP P PP PPPPP P PPP P P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPP 313 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P PP P PP P PPPPPP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX---PPPPPP 462 PP PP PPPP P PPPPPP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXP---XPPPPPPXXXPXPXPPXP 431 P P P P PPP P PPPPPP PP P Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PP PPP P P P PPP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPP 325 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 9/51 (17%) Frame = -3 Query: 507 PPPPXXPPXPPP---------PPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 PPPP PP P PPP P PP P P P F Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPPF 330 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 415 GGGXXG-GGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGG 537 GGG G GGG G G G G G G G GG G GGG GG Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGG G G G G GG GG G Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAG 462 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 KG GG G G G G GGGG GG GG G Sbjct: 429 KGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +1 Query: 355 GXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXR 531 G K +KG G G G GGG G GG GGG G G Sbjct: 389 GVASKEAESQKGTSPSGGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGN 448 Query: 532 GGXG 543 G G Sbjct: 449 GNAG 452 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG GG G G G G G G GG G G G Sbjct: 426 GGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GGG G G G G G G Sbjct: 405 GGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG G G GG GG G G G G G Sbjct: 410 GTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNG 454 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/76 (27%), Positives = 22/76 (28%), Gaps = 1/76 (1%) Frame = +3 Query: 354 GXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGG-GGGGXGXXGGGGXGXXXXXX 530 G K +KG G GG G GG G G G GGG G Sbjct: 389 GVASKEAESQKGTSPSGGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGN 448 Query: 531 GGXXGXGXXXXGXXXG 578 G G G G Sbjct: 449 GNAGNGGAGGGGAGGG 464 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXP 453 PPP P PPPP PP PPPPP P Sbjct: 54 PPPPPPPPPP--PPPPPPPPSSSP 75 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP PP PPPPPP PPPP P P Sbjct: 54 PPPPPPPPPPPPPP-------PPPPSSSPSRP 78 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXP 453 PPP P PPPP PP PP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXP 431 PPPP P PPPPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPP 436 PPPP PP PPPPPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 PP PPP P PPPP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP PPPPPP PPPP PPP P P S Sbjct: 54 PPPPPPPPP-------PPPP--PPPPPSSSPSRPLTS 81 Score = 35.5 bits (78), Expect = 0.058 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP 474 P PP PPP P PPPP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 487 PXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPPPPP P P PP PL Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRPL 79 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = -1 Query: 536 PPLXPPPXPXPP---PPXXPPXPPPPPPXXPXXXXPP---PPXXPPP 414 PP PPP PP PP P PPP P PP PP PPP Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP+ P P P P P P PPP PPP PP P P Sbjct: 2150 PPPPMGPARHSPSGPSPLGAP-PSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP--PXPXXPPP 415 P P P P P PP PPP P P P P PPP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP PP PP P P P P P Sbjct: 2180 PPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAP 2224 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP--XPXXXPP 416 P P PP PPP P PPP P PP P PP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ PP PPP PP PP P PPP P P Sbjct: 2185 PPMGAPPS-GPPPMGTPPSGHPPMGAPP--MGPPPSGSHSPAP 2224 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP----PXPPPPPPXXPRXPXP--PXPXXPPP 415 P PP PPPP P P P P P P P P PPP Sbjct: 2136 PAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPP 2186 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = -1 Query: 536 PPLXPPPXPX----PPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPP 414 P + PPP PPPP P P P P P PPP PP Sbjct: 2136 PAMGPPPMGSSRYGPPPPMGPARHSPSGPS-PLGAPPSVPPPMGAPP 2181 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP PPP P PP P PP P Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPP P PPP P P P P PP Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGPPPMGAP--PSGPPPMGTPP 2201 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/72 (26%), Positives = 21/72 (29%), Gaps = 2/72 (2%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXP--PPPXXPXPPPPPPXXXPXPXPPXPXXX 422 P P P P P P P PP P P PP P P P Sbjct: 2136 PAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAP-PSGP 2194 Query: 421 PPLXXXXXXNXP 386 PP+ + P Sbjct: 2195 PPMGTPPSGHPP 2206 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -1 Query: 521 PPXPX----PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PPPP PPPPP P P PP PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PPPP PPPPP P P P PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPP 462 P PP + PPP P PP P P PPPP Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPP---XXPXPPPPPP 464 P PP P PPPP P PP PPP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXX-PPPXP 408 PP P PPPPP PPPP P P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGP 677 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = -1 Query: 536 PPLXPPPXPX------PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP P PPP P PPPP P PPP PPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP P PPPPP P PP P PP Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP P PPPP P P P PPP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXP---PPPPPXXXPXPXPPXPXXXPPL 413 P PP PPP P PPPPP P PP P P L Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPML 324 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX-PPPPPPXXPXXXXPP 435 PP P PPPP P P PPPP P P Sbjct: 293 PPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPP 429 P PPL P P P PP PPP P P PPPP Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPP-PPPLPAGVPAPPPPPPP 321 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/60 (46%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +1 Query: 382 KKGXXXXXXGXGG-GXXGGGGXXXXGXXG--GGGGGXGGXXGG--GGXG-XGGGXRGGXG 543 KK G GG G GGG G G GGGGG GG GG GG G GG +GG G Sbjct: 179 KKAADLGAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYG 238 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +2 Query: 359 KXKKXXXKKRGVXXXXXXXGGGXXGXGGXGXRGXXGG-GGGGXGGXXGGGGXXXXXXXGG 535 K K KK G G G G RG G GGGG G GGG GG Sbjct: 172 KGKDVEMKKAADLGAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGG 231 Query: 536 XXGXG 550 G Sbjct: 232 YSQGG 236 Score = 32.3 bits (70), Expect = 0.54 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +2 Query: 350 KXXKXKKXXXKKRGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGG-XGGXXGGGGXXXXXX 526 K + KK G GGG G G GGG GG GG GG G Sbjct: 174 KDVEMKKAADLGAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYS 233 Query: 527 XGGXXG 544 GG G Sbjct: 234 QGGYGG 239 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GG G G GG GG GG G G G G Sbjct: 209 RGGGGGSGGYGGGSYGGYG-NYGGYSQGGYGGYADNSWSGGYGSYDGGYGNGG 260 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GG GGG G GG GG GG G G GG G Sbjct: 205 RGGPRGGGGGSGG-YGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGGYG 257 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P PP P P PP P P PPP P PPP P PPP Sbjct: 58 PIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P PP P P PP P P PPP P PPP P PPP Sbjct: 48 PIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P P PP P P PP P P PPP P PPP P PPP Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP P P P P P PPP Sbjct: 48 PIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXP--PXPXXPPP 415 P P PP PPP P P PPP P P P P P PPP Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = -1 Query: 524 PPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 PP P P PP P P PPP P PPP P PPP Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP----XXXPXPXPPXPXXXPP 416 P P P PP P PPP P P PPP P P P P PP Sbjct: 53 PPPNIPIPGNPP-PNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXP--RXPXPPXPXXPPP 415 PP PPP P PPP P R P P P PPP Sbjct: 14 PPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPP 55 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXP--PXPPPPPPXXPXXXXPPP----PXXPPP 414 P PPP P P P P PPP P PPP P PPP Sbjct: 30 PRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPP 75 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP P PPP P P PPP P P P P Sbjct: 73 PPPNTPIPGDPP-PNTPIPGNPPPNTPIPGDPPP-NTPIPGDPPP 115 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP P P PP P PPP P P P P P PP P P Sbjct: 54 PPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP P P PPP P P P P P Sbjct: 78 PIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDP 123 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP--PXPXXPPP 415 PP PPP P PP P P P P P PPP Sbjct: 24 PPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPP 65 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP P PP P PPP P P P P P PP P P Sbjct: 34 PPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXP-PXPPPPPPXXPXXXXPPPPXXP 420 P P PP P P PPP P P PPP P PPP P Sbjct: 78 PIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIP---GDPPPNTP 118 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP--PXPXXPPP 415 PP PPP P PPP PR P P P PP Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPP 45 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -1 Query: 533 PLXPPPX---PXPPPPXXP-PXPPPPPPXXPXXXXP--PPPXXPPP 414 P PPP P PPP P PPP P P P P PPP Sbjct: 10 PGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPP 55 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = -1 Query: 533 PLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPP----PXXPPP 414 P PPP P PP P PP P PPP P PPP Sbjct: 20 PGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPP 65 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXX 422 P P P PP PP P PPP P P P P P Sbjct: 14 PPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDP 73 Query: 421 PP 416 PP Sbjct: 74 PP 75 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXX 422 P P P PP PP P PPP P P P P P Sbjct: 24 PPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDP 83 Query: 421 PP 416 PP Sbjct: 84 PP 85 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G G GGG GG GGG GG GG G Sbjct: 160 GDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGG-ADGGDDDGGDG 203 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 G GG GG G GGG GG G GGG GG G G Sbjct: 137 GLVGGGDNGGVVDVVVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGG 182 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXG--GXXGG----GGXGXGGGXRGG 537 GGG GG G GGG G G GG GG G GGG GG Sbjct: 140 GGGDNGGVVDVVVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGG 186 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GG GGG G GGG G G GG G G G Sbjct: 175 GGDGDGGGDDGGGADGGGADG-GDDDGGDGDGDDDG 209 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 409 GXGGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXG 513 G GGG GGG G G GG G G GG G Sbjct: 178 GDGGGDDGGGADGGGADGGDDDGGDGDGDDDGGDDDG 214 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 G G G GG G G G GGG G GGG G G GGG G G Sbjct: 299 GMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPG 344 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGG 525 G G G GG G G G G GGG G GG G G GGG Sbjct: 283 GWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGG 322 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGG-GXGXGGGXRGGXG 543 G G G GG G G G G GGG G GGG G GGG G G Sbjct: 314 GMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPG 360 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G G G G GGG G G G GG G Sbjct: 251 GWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSG--GGWG 293 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G G G G GG G GGG G G G GG G Sbjct: 267 GWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG--GGWG 309 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/54 (44%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-----GGGXGGXXGGG-GXGXGGG---XRGGXG 543 G GGG G G GGG GGG G GGG G G GGG +GG G Sbjct: 263 GPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMG 316 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G G GG G GGG G G G G G Sbjct: 235 GSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRG 279 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXG-GXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GGG G G GG G GGG G G Sbjct: 259 GWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG 305 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +1 Query: 409 GXGGGX----XGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G G G G GG G GGG G G G G Sbjct: 318 GPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWG 364 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG G G G GG G G G G GG G Sbjct: 257 GGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMG 301 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGG---GXGXGGGXRG 534 G G GG G G G G GGG G GGG G G G G RG Sbjct: 322 GWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWGCRG 367 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGG-----GGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GG G G GGG GGG G GGG G G G G Sbjct: 275 GMGRGPGG-GWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGG 322 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG GG G G G G GGG G GGG G G G G G Sbjct: 306 GGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQG 362 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG-----GGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG GGG G GGG G G G G Sbjct: 320 GGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWGCRGMG 369 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G G G G GGG G G G G G Sbjct: 229 GPGIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRG 271 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G GG GGG G GGGGGG GG GG G Sbjct: 68 GAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGG--XXGGG--GXGXGGGXRGGXG 543 G G G GG GGG GG GGG G G GGG GG G Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAG 93 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG GG G G G GG GG GG GGG Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 35.1 bits (77), Expect = 0.077 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +1 Query: 409 GXGG---GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG--XRGGXG 543 G GG G GG G G GGG G GGGG G GG GG G Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 431 GXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GG G GG GGG GG GG GG G G Sbjct: 53 GDGGDDC-GDDGGAGGGAGGDDDDGGGISGCGDGGGGGGG 91 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G G GGG GG GGG G GG G G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDG 99 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G G GG G G G G G G +GG G Sbjct: 35 GQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDG 79 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG--GXXGGGGXGXGGGXRGGXG 543 G G GG G G G GG G G G G GG G GG G G Sbjct: 30 GDGQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQG 76 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G GG G G G G GG G GG G G G Sbjct: 35 GQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDG 79 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GG G G G GG G GG G G G G Sbjct: 43 GDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDGPG 81 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P P P P PP P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P+ P P PPPP P P P P P P P PP P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PPPP P P P P P P PP Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPP 1694 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P P P P P P P P P Sbjct: 1665 PPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYP 1709 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P+ P P P PP PP P P P PP Sbjct: 1675 PDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PP P P P P PP P P Sbjct: 1655 PVFHYPAPPPPP---PPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PP P P P P P P+ P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGP-PGPPGLPGP 1702 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP----XXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P PPP PP P PPP PP PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPP 65 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = -1 Query: 542 PXPPLX--PPP---XPXPPPPXXPPXPPPPPPXXPXXXXPP---PPXXPPPXP 408 P PP PPP P PP P PP PP P PP PP PP P Sbjct: 25 PTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P + PP P PPP P PP P PP PPP + P Sbjct: 35 PGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP P P P PPP P PP P PP+ Sbjct: 20 PKPPQPTPPKPDTPPPGTN-IPTPPSPNTPPPV 51 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPP--PPPPXXPRXPXPPXPXXPPP 415 P P PP PP P PP PP PP P PP PPP Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PP P PP P P P PP P P P PP+ Sbjct: 23 PQPTPPKPDTPPPGTNI-PTPPSPNTPPPVTQPPVTQP-PVTQPPVTQPPV 71 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPPP 414 P P PP P PP P PP PP P PPP Sbjct: 14 PVDQATPKPPQ--PTPPKPDTPPPGTNIPTPPSPNTPPP 50 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP P P P P PPP P P P PP+ Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQP-PVTQPPVTQPPV 66 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGG---GGGGXGGXXGGGG-XGXGGGXRGGXG 543 GG GGGG G GG GG G G GGGG G G G GG G Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQG 210 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGG---GGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 +G G GGG GG GG G G G GG GGG G GGG Sbjct: 159 RGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGG 208 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGX-GGXXGGGGXGXGGGXRGGXG 543 G GGGG G GG GG GG GG G GGG GG G Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGG--GYGGGGEGGYG 177 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG GGGG GG GGG G G GG G Sbjct: 177 GMGGGDYSGG-CGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGG 220 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGG-XRGGXG 543 G GGG GG G GG GG GG GG G GGG GG G Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCG 188 Score = 33.9 bits (74), Expect = 0.18 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +3 Query: 414 RGGXXXGX-GGXGXGXXXGGGG-GGXGXXGG---GGXGXXXXXXGGXXGXGXXXXGXXXG 578 RGG G GG G GGGG GG G GG GG G GG G G G Sbjct: 151 RGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQG 210 Query: 579 XXXXXG 596 G Sbjct: 211 YGSYSG 216 Score = 33.1 bits (72), Expect = 0.31 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGG---GGGGXGGXXGGGG-XXXXXXXGGXXGXG 550 RG GGG G GG G G GG GG G G GGGG GG G G Sbjct: 155 RGGYRGGRDRGGGYGG-GGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYG 212 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 RGG G G G GGG G G GG G G G G G G Sbjct: 147 RGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYG 206 Query: 594 G 596 G Sbjct: 207 G 207 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXX---GGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G G G G G GG G GGGG GG G G G Sbjct: 164 RGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGG 217 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGG--GGXXXXGXXGGG-GGGXGGXXGGGGXGXGGG 525 +G G GG GG GG GGG GGG G G GG GG Sbjct: 137 RGRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGG 186 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G RG GG GG GGGG GG G Sbjct: 143 GGGYRGGYRGGYRGGYRGGRD-RGGGYGGGGEGGYGMGGGDYSGG 186 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G + G GGG GGG GGG G G GGGG Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGY-----GGGQGYGSYSGGGG 219 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PP 414 + PP P PP P PP PP PP P PP P P PP Sbjct: 704 MGPPGLPGPPGPASPPSPPG-PPGPPGPNGPPGPNGPLGPP 743 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PP 414 + PP P PP P PP PP PP P PP P P PP Sbjct: 789 MGPPGLPGPPGPASPP-SPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLX-PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PP P PP P P P PP PP P Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPG--FPGPQGPNGPKGPPGLPGPPGP 74 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPPPXP 408 PP PPP PPP PP PP P PP P P P PP P Sbjct: 29 PP--PPPPYEAPPP--PPGPPGPDGPPGFPGPQGPNGPKGPPGLP 69 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 PP PP P PP P PP P P PP P PP Sbjct: 102 PPGELGDMGPPGPPGPPGPQMPP-GPPGLPGPPGPAGPP 139 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 + PP P PP P PP PP PP P PP P Sbjct: 874 MGPPGLPGPPGPASPP-SPPGPPGPPGPKGPPGP 906 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PP 414 + P P PP P PP PP PP P PP P P PP Sbjct: 619 IGPAGLPGPPGPASPP-SPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPP--LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PP 414 P PP + PP P PP P PP PP P P PP P PP Sbjct: 273 PGPPGDMGPPGLPGPPGPQMPPG-PPGLPGAPGPKGPPGTNGPLGPP 318 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P PP P P P PP PP PP P Sbjct: 112 PGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNP 157 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP PP P PP P P PP P PP Sbjct: 692 PGINGPPGQIGEMGPPGLPGPPGP-ASPPSPPGPPGPPGPNGPP 734 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP PP P PP P P PP P PP Sbjct: 777 PGINGPPGQVGEMGPPGLPGPPGP-ASPPSPPGPPGPPGPKGPP 819 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP PP P PP P P PP P PP Sbjct: 862 PGINGPPGQVGEMGPPGLPGPPGPASPPSP-PGPPGPPGPKGPP 904 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PP 414 P + PP P PP P PP PP P P PP P PP Sbjct: 360 PLGDVGPPGLPGPPGPQMPPG-PPGLPGAPGPKGPPGTNGPLGPP 403 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPP 435 P P PP P P P P PP P PP P PP Sbjct: 44 PPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPP 81 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPP 417 PP P PP PP P PP P PP P PP Sbjct: 102 PPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP---PPXXPP 417 P + PP P PP P PP PP P P PP P PP Sbjct: 445 PLGDVGPPGLPGPPGPQMPPG-PPGLPGAPGPNGPPGINGPLGPP 488 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP---PPXXPP 417 P + PP P PP P PP PP P P PP P PP Sbjct: 530 PLGDVGPPGLPGPPGPQMPPG-PPGLPGAPGPNGPPGINGPLGPP 573 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPP-PPXXP-PPXP 408 P + PP P P PP PP PP P PP PP P PP P Sbjct: 84 PAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGP 135 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXP-PXPPPPPPXXPXXXXPPPPXXPP 417 P PL PP P PP P P P PP P P P PP Sbjct: 181 PNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPPPXP 408 P P P P PP PP PP P P P PP P Sbjct: 175 PNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLP 215 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 487 PXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P PPPP P P PP P P N P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGP 65 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPP 417 P L PP P P P PP P PP P P P PP Sbjct: 266 PNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXP 430 P PP PP PP P PP PP P P P P Sbjct: 352 PGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGP 393 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP 468 P P PP P PP P P PP P Sbjct: 627 PPGPASPPSPPGPPGPPGPKGPPGP 651 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP 468 P P PP P PP P P PP P Sbjct: 797 PPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP 468 P P PP P PP P P PP P Sbjct: 882 PPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXX-PXPP--PPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXX 395 P P P PP P P PP P PP PP P P P L Sbjct: 40 PPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGV 99 Query: 394 NXP 386 N P Sbjct: 100 NGP 102 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PP P P P PP PP PP P Sbjct: 282 PGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNP 327 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PP P P P PP PP PP P Sbjct: 367 PGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNP 412 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXP 430 P PP PP PP P PP PP P P P P Sbjct: 437 PGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGP 478 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXP 430 P PP PP PP P PP PP P P P P Sbjct: 522 PGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGP 563 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP 468 P P PP P PP P P PP P Sbjct: 712 PPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P PP PP P PP P P PP P P P Sbjct: 339 PAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 388 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P PP PP P PP P P PP P P P Sbjct: 424 PAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 473 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PP P P P PP PP PP P Sbjct: 452 PGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNP 497 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P PP PP P PP P P PP P P P Sbjct: 509 PAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 558 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PP P P P PP PP PP P Sbjct: 537 PGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNP 582 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP--PP 462 P P PP P PP P PP P P PP Sbjct: 630 PASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPP-LXPPPXPXPP--PPXXPPXP-PPPPPXXPXXXXPPPPXXPP 417 P PP + PP PP P P P PP P PP P PP Sbjct: 689 PGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPP-LXPPPXPXPP--PPXXPPXP-PPPPPXXPXXXXPPPPXXPP 417 P PP + PP PP P P P PP P PP P PP Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P P PP P P P P P PP P Sbjct: 792 PGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGP 833 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPP-LXPPPXPXPP--PPXXPPXP-PPPPPXXPXXXXPPPPXXPP 417 P PP + PP PP P P P PP P PP P PP Sbjct: 859 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P P PP P P P P P PP P Sbjct: 877 PGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGP 918 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P P P P P P P PP P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = -3 Query: 543 PXXPPXXXXXXXPP--PPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP P P P PP P P PP PP Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPP 81 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P P P P P P PP PP P P P Sbjct: 169 PAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGP 223 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPP-LXPPPXPXPP--PPXXPPXP-PPPPPXXPXXXXPPPPXXPP 417 P PP + PP P PP P P P PP P P P PP Sbjct: 434 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 479 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPP-LXPPPXPXPP--PPXXPPXP-PPPPPXXPXXXXPPPPXXPP 417 P PP + PP P PP P P P PP P P P PP Sbjct: 519 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 564 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P P PP P P P P P PP P Sbjct: 707 PGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGP 748 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PP P PP P Sbjct: 691 PPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPP 728 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PP P PP P Sbjct: 776 PPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPP 813 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PP P PP P Sbjct: 861 PPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPP 898 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP--PXXPXXXXPPPPXXP--PP 414 P PP P P P P P PP PP P P PP P PP Sbjct: 188 PGPPGDMGP-PGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPP 233 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPP-PPPPXXPRXP-XPPXPXXP 421 P P PP P PP PP P P P P PP P Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGP 663 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P PP P P P P P PP P Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGP 663 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPPPPXXPPPXP 408 P P P P PP PP P P P PP P PP P Sbjct: 594 PAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPP 643 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PP PP P P P P Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PP PP P P P P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPP-PPPPXXPRXP 445 P P P PP PP P PP P PP P P P Sbjct: 777 PGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGP 827 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PP PP P P P P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PP PP P PP PP PP Sbjct: 112 PGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGEL-GPPGDVGPP 154 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXP-PPPPPXXPRXP 445 P P P PP PP P PP P PP P P P Sbjct: 692 PGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGP 742 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPP-PPPXXXPXPXPPXPXXXPP 416 P PP P P PP PP P P P P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP P P PP P PP P P PP P Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGP--LGPPGESGP 663 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 9/51 (17%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP----PPPPXXPXXXX-----PPPPXXPP 417 P P PP P PP P PP P PP P P P PP Sbjct: 885 PASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPPCPP 935 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P PP P PPPPPP P P P PP P Sbjct: 786 PATPRVPPNIPSRPPGARP-TPPPPPPGKP--TKPTKPSLPPVPP 827 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 L PP P PP P PP P P P PP PP P K Sbjct: 774 LGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTK 819 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PPP P P PP P PP PPPP P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXP--PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPPPP P P PP Sbjct: 781 PPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPPP P P PP P P PPP P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPT-PPPPPPGKPTKP 817 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP P P P PP P PP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P P PPPP P P P P PP Sbjct: 782 PPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLP-PVPP 827 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P P PP PPP PP P Sbjct: 696 PPPRPMAPKDASLHRASSPPGFTHKGSEPPPKPAPPARP 734 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGG-GXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GG GG G GG G G G GGG G G Sbjct: 230 GGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGGVIGTGG 275 Score = 35.1 bits (77), Expect = 0.077 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGX--GXGGGXRGG 537 G GG G GG G GG GG G G GGGG G G G GG Sbjct: 224 GAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGG 269 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GGGG G G GGG G GG GG Sbjct: 236 GGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGGVIG-TGGIPGG 279 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 420 GXXXGXGGXGX-GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G GG G G G GGGG G G G GG G Sbjct: 236 GGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGGVIGTGGIPG 278 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P + P P P PP PPP P P P PPP P Sbjct: 519 PPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAP 563 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + P P P PP PPP P P P PPP Sbjct: 541 PPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPPP 583 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P + P P PP PPP P P P PPP P Sbjct: 497 PPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAP 541 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + P P PP PPP P P P PPP Sbjct: 381 PPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPP 423 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXP---PPPPPXXPXXXXPPPPXXPPP 414 P P PPP P P P P P PPP P P P PPP Sbjct: 393 PTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPP 441 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + P P PP PPP P P P PPP Sbjct: 439 PPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPP 481 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXP---PPPPPXXPXXXXPPPPXXPPP 414 P P PPP P P P P P PPP P P P PPP Sbjct: 451 PTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPP 499 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 8/53 (15%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-----PXP---PPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP PPP P P PPP P P PPP P Sbjct: 351 PTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAP 403 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P P P P PPP P P P PP Sbjct: 537 PPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPP 582 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PP PPP P PPP PPP Sbjct: 332 PPVTEPAPPSSVVAPPPAVPTPATA--PPPVVAPPP 365 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP + PPP P PP PPP P P PP Sbjct: 337 PAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPP 382 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPP----PPPXXPXXXXPPPPXXPPP 414 P P PP P PP PPP P PPP PP Sbjct: 321 PQMVAPSSTVTPPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPP 364 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP--XPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P P PPP P P PPP P Sbjct: 415 PTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPPPAP 461 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PP PPP P P PPP PPP Sbjct: 559 PPPAPPPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPP---PPXXPPXPPPPPPXXPXXXXPPPP 429 P P PPP P P P P P PP PPP Sbjct: 553 PTPVTAPPPAPPPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXPP 416 P PP P P PP PPP P P P PP Sbjct: 377 PVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPP 422 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXPP 416 P PP P P PP PPP P P P PP Sbjct: 435 PVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPP 480 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXPP 416 P PP P P PP PPP P P P PP Sbjct: 515 PPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPP 560 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 6/49 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXX--PXXXXPP----PPXXPPP 414 P P PPP P P PPP P P PP PPP Sbjct: 473 PTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPP 521 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G G GG G GGG G GG GG G Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQG 151 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG G GG GGG G G Sbjct: 136 GGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSG 179 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGGG GGG G G G G GG GG Sbjct: 115 GEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGG 157 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGG GG G GG GG G Sbjct: 129 GQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGG 173 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GG GG G G G GGG GG G Sbjct: 104 GGTAEGGGEAG-GEAGGQAGGGGQAGGQAGSQAGGGAAGGGG 144 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GGG GG GG G G G Sbjct: 128 GGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGG 172 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG-XGGGXRGGXG 543 G G G GG GG G GG G G GGG G G Sbjct: 147 GGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAG 192 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 416 GGGXXGXGGXGXR--GXXGGGGGGXGGXXGG---GGXXXXXXXGGXXGXG 550 GGG G G + G GGGG GG GG GG GG G Sbjct: 122 GGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGG 171 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GG GGGG GGG G G GG Sbjct: 165 GGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAGG 200 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG---GGGXGXGGGXRGGXG 543 G GG G GG G GG G G GG G GGG G G G GG G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSG--GGWG 49 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G G GG G GGG G G G GG G Sbjct: 23 GWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG--GGWG 65 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGX-XGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 +G G GGG G GG G GG G G GG G G G G +GG Sbjct: 3 QGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGG 54 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-----GGGXGGXXGGG-GXGXGGGXRGGXG 543 G GGG G G GGG GGG G GGG G G GGG G G Sbjct: 35 GPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPG 85 Score = 35.9 bits (79), Expect = 0.044 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXG-GXXGGGGXGXGGGXRGGXG 543 G G G GG G G G G GGG G G GG G GGG G G Sbjct: 15 GWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG 61 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GGG G GG G GGG G G Sbjct: 31 GMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPG 77 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG-----GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGX 581 GG G GG G G GGG GGG G GGG G G G G G Sbjct: 6 GGWGRGSGG-GWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGW 64 Query: 582 XXXXG 596 G Sbjct: 65 GRMQG 69 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG-----GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGX 581 GG G GG G G GGG GGG G GGG G G G G G Sbjct: 22 GGWGRGQGG-GMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGL 80 Query: 582 XXXXG 596 G Sbjct: 81 GRGPG 85 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG G G G GG G G G G GG G Sbjct: 53 GGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMG 97 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 432 GXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G G G GGG G GGG G GG G G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMG---RGPGGGWGRG 43 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 12/54 (22%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGG-----------GXGXGGGXRG 534 G G G GG G G G G GGG G GGG G G G G RG Sbjct: 55 GMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQGWGCRG 108 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G GGG G GGG G G G G G G Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQG 53 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGG-----GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GGG GGG G GGG G G G G G Sbjct: 45 GGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQG 103 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG G G G GG GGG GG G G GGG GG Sbjct: 208 GGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGG 248 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG GGGG GGGGG G G G GG G Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG--XGGXXGGGGXGXGGG 525 G G GG G GGGGGG G GGGG GGG Sbjct: 209 GMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGG 249 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G GG G G G GG G GGG G GG G Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG G G GGG G G GGGG GG Sbjct: 229 GGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGG 267 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG G G GG GG G G G GG GG Sbjct: 225 GFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGG 267 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 GG G GG GG G GG G GG GG G Sbjct: 195 GGSIEKGWVGGRAGGMNSGYNGGPAPGAVGGFGGGGG 231 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GGG G GGGGG G GG Sbjct: 240 GGGGGYSGGGSGTHSGQAGGGGG--SYCGGSSCSAVTGG 276 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GG GGG G GGG G G GG GG GGG GG Sbjct: 353 GDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG---XGGGXRGG 537 G GG GGG G GGG G GG GGG G GGG GG Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHG-GGDHGGGDHGDGDHGGGDHGG 387 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +1 Query: 415 GGGXXG----GGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGG 537 GGG G GGG G GGG GGG G GG GGG GG Sbjct: 346 GGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG G GG GGG G G G G Sbjct: 338 GDPGGGDPGGGDPGGGDPGGGDPG-GGDHGGGDHGGGDHGDGDHG 381 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG G GG GGG G G G G Sbjct: 363 GDHGGGDHGGGDHGDGDHGGGDHG-GGDHGGGDHGGGDYGDGDHG 406 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 GG G G G GGG G G GG GG GGG GG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGG 367 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG---GGGXGGXXGGGGXGXGGGXRG 534 G GG GGG G GGG GG GG GGG GGG G Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGG-DHGGGDHG 376 Score = 35.1 bits (77), Expect = 0.077 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG---GGGXGGXXGGGGXGXGGGXRGG 537 G G GGG G GGG GG GG GGG GGG GG Sbjct: 328 GDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGG-DHGGGDHGG 372 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +1 Query: 415 GGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGG G G GGG GG GGG GG G Sbjct: 361 GGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGDG 403 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G GGG GG GGG GG G G Sbjct: 326 GDGDHGDGDHG--GGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGG 368 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G GGG GG GGG GG G G Sbjct: 331 GDGDHGGGDPG--GGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 422 GXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G GGG GG GGG GG G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGG 367 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GGG G GGG GG G G G G G Sbjct: 336 GGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGG 388 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXGXGGG 525 GG GGGG G GGGGGG GG G GGG Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGG 504 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGG 537 G GG GG GG GG G GGG G GGG GG Sbjct: 456 GAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 431 GXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 G GG G GGGGGG GG GG GG G Sbjct: 469 GFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G G G GGGG G GGGG G GG G Sbjct: 456 GAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASG 495 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 409 GXGGGX--XGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GGGG G GG G GGGG G Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 GG G GG GG GG GG G GGG G G Sbjct: 439 GGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGG 481 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG GG GG G G G GGG GG Sbjct: 446 GEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGG 488 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GG G G GGG GG GG GG G GG GG Sbjct: 1198 GYDGSDDGGDGGYG-GSDGGGDGGYGGIDSGGDGGCDGGIDGG 1239 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G GG GGG G GG GG G GGG G Sbjct: 1208 GGYGGSDGGGDGGYGGIDSGGDGGCDGGIDGGGDG 1242 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G GG GG G GG GG GG GGG G Sbjct: 1209 GYGGSDGGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG GG G GG G G Sbjct: 1192 GAECDGGYDGSDDGGDGGYGGSDGGGDGGYGGIDSGGDGGCDG 1234 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G GG G GG G G Sbjct: 1206 GDGGYGGSDGGGDGGYGGIDSGGDG---GCDGGIDGGG 1240 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP PPP PP P PP PPP P K F S Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQPTGDLKCNFDS 467 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 536 PPLXPP-PXPXPPPPXXPPXPPPPP 465 PP PP P P PPP PP PPP Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PP PP PPP P PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 PPP PP PPP PP P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PPP P P PP P PPP P PPP Sbjct: 430 PPPTPPPTPP-----PTPPPTTLPPTTQPPP 455 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP 477 P PP PPP PP PP P Sbjct: 436 PTPPPTPPPTTLPPTTQPPPQP 457 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP---PXXPXXXXPPPPXXP 420 P P PPP P P P PP PP P P P PPPP P Sbjct: 850 PLSPSAPPPLP-PRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 11/51 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXX-----------PXXXXPPPPXXPP 417 P L P P P PP PPPP P P PPP PP Sbjct: 868 PSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPPP 918 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXP 430 P PP PP PP P P PP P PP P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG G GG G GG G G GGG G GGG Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGG 374 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G GG GG GG G GGG RGG G Sbjct: 334 GDSRGGGRGGRGGRPGRGG-RGGRGASGGRGRGGG-RGGFG 372 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 + +G G G G GG G G GGG G G G G G Sbjct: 335 DSRGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP--PXXPXXXXPPPP 429 P L PPP PPP PP PP P P PPPP Sbjct: 213 PGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP-PPPXXPPPXPXXXXKXP 387 P PP PPP PP PP P P PPP PP P P Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRP 257 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -1 Query: 542 PXPPLXPPPXPXPP---PPXXPPXPPPPP-PXXPXXXXPPPP 429 P P + PPP PP PP P PPP P P P PP Sbjct: 217 PPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP--RXPXPPXPXXPPP 415 P PP PPP PP PP P P PP PPP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPP 249 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PP PPP P PP P P PP P PP Sbjct: 209 PNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFP-PPGPIPPPP 250 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPPXXXPXPXPP 437 P P P P PP PP P PPP PPP PP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG G GG GGG G GGG G GGG GG Sbjct: 216 GGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGG 250 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGG 525 G GG GGGG G GGGGGG G G G GGG Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG GG GG G GG G GGG G G Sbjct: 214 GVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G GG G GGGGGG G GGG G G G Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGG 264 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 437 GGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GG G G GGGGGG G GG G GG G Sbjct: 230 GGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGG-------XGGXXGGGG-XGXGGGXRGGXG 543 GG G GG GG GG GG GGGG G GGG GG G Sbjct: 197 GGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGG 246 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG G GG GG G G G GGG GG Sbjct: 204 GEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGG 246 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GG G G GG G GG GGGG GG Sbjct: 214 GVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GG G GG G GG G Sbjct: 180 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVG 216 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = -1 Query: 524 PPPXPXPPPPXXPP---XPPPPPPXXPXXXXPPP 432 PPP PPP PP PPPPPP PPP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PP PPPPPP PP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPP---XPXXPPP 415 PPP PP PP P P PP P PPP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFF 381 P P P PPP P PP PPP P P + Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAY 239 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P PP PPP PPP PP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPP 232 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPX----PXXXPPL 413 PPP P P PP P P PP P PP+ Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPPV 243 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GG GGG G GGGG G GGG GG Sbjct: 477 GGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG GG GG GGGG G GGG G Sbjct: 475 GVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSG 510 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGX-------GGXXGGGGXGXGGGXRGGXG 543 GG G GG GG GG GG GGGG GGG GG G Sbjct: 458 GGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGG 506 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGGG GG GGGG G GG G Sbjct: 488 GFGGGGGASGGGGGGGGGGGFSGGACG 514 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXGXGGGXRGG 537 GG GGGG G GGGGGG GG G G GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G GGGGGG G GG G G G Sbjct: 488 GFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G GGG GG GGGGGG GG GG Sbjct: 488 GFGGGGGASGG-------GGGGGGGGGFSGG 511 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 GGG GGGG G G G GGGG Sbjct: 498 GGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GG G GG G GG G Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVG 477 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRG 534 GGGGG GG GGGG G GG RG Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXG 519 G GGGGGG GG G GG G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 469 GGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGG G GGG G GGG RGG G Sbjct: 514 GGGGGG----GGGGGGGGGGRGGRG 534 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGG 508 R GGGGGG GG GGGG Sbjct: 510 RRRRGGGGGGGGGGGGGGG 528 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGG 508 R GGGGGG GG GGGG Sbjct: 511 RRRGGGGGGGGGGGGGGGG 529 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGG 508 RG GGGGGG GG GG G Sbjct: 513 RGGGGGGGGGGGGGGGGRG 531 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 446 GXRGXXGGGGGGXGGXXGGGG 508 G G GGGGGG GG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGG 503 GG G G GGGGGG G G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXG 512 G G GGGGGG G GG G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 437 GGXGXRGXXGGGGGGXGGXXGGG 505 GG G G GGGGGG G G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 GGGG G GGGGG GG GG G G Sbjct: 514 GGGGG---GGGGGGGG--GGGRGGRGRG 536 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPP P PPPP P PP P PPP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPP P PPPP P PP P PPP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP 438 PP PP P PP P PPP P P P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PPP P PPP P PP P PPP P Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLPAG---PPPDEP 543 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P P PPP P PP P PPP P Sbjct: 514 PPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 524 PPPXPXPPPPXXPP--XPPPPPPXXPXXXXPPPPXXPPP 414 PPP PPP P P PPP PPPP PPP Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPP 401 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PPPP PP PP PPP PPP Sbjct: 383 PPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPP 423 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPP PPP PPP PPPP P P Sbjct: 393 PPPPLIPPPQASIPPPTMIQTLPPP-------SVPPPPIGVPNRP 430 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 10/53 (18%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPP----------PPPXXXPXPXPPXPXXXPP 416 P P PPPP P PPP PPP P PP P PP Sbjct: 349 PVIVPPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPP 401 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXP-PPXPXP-------PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PP P PPP P PPPP P PP PPP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIP----PPQASIPPP 408 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPP---PPPPXXXPXPXPPXPXXXPPL 413 P PP PPPP P P PPP P P P PP+ Sbjct: 380 PHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVP--PPPI 424 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 430 GGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGG 525 G GG G GG GGGG GGG G GG Sbjct: 2312 GEGGESRAGPVGGFGGGGSSRIRPGGGGGYSGG 2344 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP-XPPXPXXXP 419 P P P P PPP PPP P P PP P P Sbjct: 383 PPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVP 427 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP---PXPXXPPP 415 P PP PPP P P P P P P P PPP Sbjct: 349 PVIVPPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPP 396 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GG G G GGGG GGGG GG Sbjct: 2311 GGEGGESRAGPVGGFGGGGSSRIRPGGGGGYSGGG 2345 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PPP PP PPP + PP PP Sbjct: 365 PIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPP 423 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP--PXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXX 369 P PL PP P PP PP PP P P PP PP P P + Sbjct: 314 PQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSP 373 Query: 368 FXXXPXXXXXXP 333 P P Sbjct: 374 LRYLPSPIRYPP 385 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PP PP P PR P P P P Sbjct: 336 PSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSP 380 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PP P PP P P P PP PP P Sbjct: 259 PSPPRYPPS-PLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPP 304 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PP PP PP PP P P PP P P Sbjct: 286 PTLPPRYP-PSPPRYPPSPPRYPP--SLHRYPQSPLRYPPSPIRYPPLP 331 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PP PP PP R P P P P Sbjct: 294 PSPPRYPPSPPRYPPSLHRYPQSPLRYPPSP 324 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP P PP P P P P P P PP P P Sbjct: 294 PSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHP 346 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-----XPPXPXXPPP 415 P P P PP PP PP PP PR P P P PP Sbjct: 273 PIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPP 322 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 7/62 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP-------XPPPPPPXXPRXPXPPXPXXPPPXXXXXXXT 391 P P P P PP PP PP PP PR PP P PP + Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPR--YPPSPPRYPPSLHRYPQS 316 Query: 390 PL 385 PL Sbjct: 317 PL 318 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/75 (29%), Positives = 24/75 (32%), Gaps = 12/75 (16%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPP--PPPPXXXPXP----------XPPXPXXX 422 P P P P P PP P PP PP P P PP P Sbjct: 268 PLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRY 327 Query: 421 PPLXXXXXXNXPFFP 377 PPL + P +P Sbjct: 328 PPLPSRYPPSPPRYP 342 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP PP P PR P P P PP Sbjct: 317 PLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYP-PSPPRYPP 357 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P P P PP P P PP PR P P P P Sbjct: 322 PSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYP-PSPPRYP 363 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/83 (27%), Positives = 25/83 (30%), Gaps = 8/83 (9%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP--PXXXP--XPXP----PXPXXX 422 P P P PP P PP PP PP P P P P P P Sbjct: 324 PIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRY 383 Query: 421 PPLXXXXXXNXPFFPXXFFXLXP 353 PP + P +P P Sbjct: 384 PPSHSRYPSSHPRYPPSHLRYPP 406 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP PP PP PR P P PP Sbjct: 329 PLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYP-SSHPRYPP 371 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPP--PPXXPXPPPPPPXXXPXP--XPPXPX 428 P P P P PP P PP P P PP P P P PP Sbjct: 329 PLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHS 388 Query: 427 XXP 419 P Sbjct: 389 RYP 391 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPP 417 P P PPP PP PPPPPP P PPP P Sbjct: 148 PSSTPSSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPPPSSSP 189 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PPPPPP P P P Sbjct: 148 PSSTPSSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPPPSSSP 189 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP+ PP P PPPPP P PPPP PP Sbjct: 403 PGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPP--PP 442 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PPP PPPP P PPPP PPP Sbjct: 322 PPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP-PPPXXPP 417 P+ PP PP P PPPP P P PPP PP Sbjct: 367 PVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPP 406 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P P PPP PP P P P P PPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PP P PPPPP P+ PP P PP Sbjct: 401 PPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPP--PP 442 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 11/64 (17%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--------PPPPXXPXXXXPPPPXXP---PPXPXXXX 396 P PP P P PP PP PP PP P PPPP P PP P Sbjct: 386 PPPPWSKPGGILPGPP--PPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPS 443 Query: 395 KXPF 384 P+ Sbjct: 444 DAPW 447 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PPP P PP P P P P PP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPP 351 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPP PP P P P P P PPP Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP--XPXPPXPXXXPP 416 P P PP PP P PPPP P P PP P P Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -1 Query: 536 PPLXPPPX--PXPPP--PXXPPXPPPPPPXXPXXXXP 438 PP P P PPP P P PPPPP P P Sbjct: 415 PPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAPWIERP 451 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXP 430 PPPP P PPPPP P P Sbjct: 426 PPPPGFPQFQPPPPPPPSDAPWIERP 451 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP----PXXPPPXP 408 P PPP P P PPP PP PP P PP P Sbjct: 383 PGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPP 428 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GG G G GGGG GG GGGG G GG Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYGG 226 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG--XXGGGGXGXGGGXRGGXG 543 G GG GGGG G GGG GG GG GGG G G G G Sbjct: 201 GYGGRGRGGGGRGGYGG-GGGYGGYGGYDQYSGGGYGGYGDSYGSYG 246 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG G G G GGGG G GG GGG GG G Sbjct: 198 GRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGY-GGYG 239 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGG----GGGGXGGXXGG-GGXGXGGGXRGGXG 543 G GGG GG GG G GG GGG GG G G GGG G Sbjct: 206 GRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYG 256 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +3 Query: 432 GXGGXGXGXXXGGGG-GGXGXXGG-GGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG G G GGGG GG G GG GG G GG G G G Sbjct: 198 GRGGYG-GRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGG 247 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 6/52 (11%) Frame = +3 Query: 414 RGGXXX-GXGGXGXGXXXGGGGGGXGXXG-----GGGXGXXXXXXGGXXGXG 551 RGG G GG G G GGGGG G G GGG G G G G Sbjct: 199 RGGYGGRGRGGGGRGGY-GGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGG 249 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXG--GGGXXXXXXXGGXXGXG 550 GGG G GG GGG GG G G GGG G G G Sbjct: 218 GGGYGGYGGYDQ--YSGGGYGGYGDSYGSYGGGGGYGSSYGSYDGYG 262 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + PP P PP P PPP P P PPP PP P Sbjct: 2610 PQMMPPMVPMMLPPMLP-LPPPGLPMQPEAPVQPPPLPPPGGP 2651 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP PP P PP P PPP P P P PPP P P Sbjct: 2604 PPDMFPPQMMPPMVPMMLPPMLPLPPPGLP--MQPEAPVQPPPLPPPGGPFP 2653 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPP 432 P + PP P PPP P P P PPP P PP Sbjct: 2618 PMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PP P PPP P P P P P Sbjct: 2596 PFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPP 2648 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 533 PLXPPPX-PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P+ PP P PPP P P PP P P P PP P Sbjct: 2592 PMQPPFFGPQLPPPDMFP-PQMMPPMVPMMLPPMLPLPPPGLP 2633 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P P P P PP P PP PPP P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P+ P P P P PP PPPPP P PP P Sbjct: 65 PVPPTPLVQHPEPEAPPQLPPPPPFI-VDDTESPQEQPPTTP 105 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P P P P P P P PPPP Sbjct: 51 PPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P P PP P P P P P P P Sbjct: 52 PPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = -3 Query: 507 PPPPXXP-----PXPPPPPPXX--PRXPXPPXPXXPPPXXXXXXXTP 388 PPPP P P P PP P P PP PPP +P Sbjct: 51 PPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESP 97 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP P PP PPPPPP PPP PP Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 6/55 (10%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPP---XXPXPPPPPP---XXXPXPXPPXP 431 P P P P P PPPP PPPPPP P PP P Sbjct: 29 PPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPP 83 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PPPPPP PPPP PP Sbjct: 27 PPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPP--PP 69 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPP P PP PPPP PPPP PPP Sbjct: 50 PP--PPPPPRFYDNDIPP--PPPPRRGFYDDYPPPP--PPP 84 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPPP P P P PPP PP Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPP 56 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGG 522 GGGGGG GG GGGG G GG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGG 525 GGGGG GG GGGG G GGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGGGGG GG GGGG G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNG 346 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGGXG 543 G GGG GGGG G GGGGGG G G G G G G Sbjct: 320 GGGGGGGGGGG----GGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDG 362 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GGGGGG G GGGG G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDG 352 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GGGG G G G G G G Sbjct: 326 GGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNG 364 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 PPL P PPPP P P PP P PP P P K Sbjct: 457 PPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPK 504 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P PP P PPP P P P P P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSP 491 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P P P PP P P P PP P P Sbjct: 458 PLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGP 509 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 L P P PPP PPPPP P PP P Sbjct: 448 LPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELP 484 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP----PPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P L PP P P P PP PP P PP P PP P P Sbjct: 437 PLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLP-LPPELPGSPGDSP 491 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXP--PPXP 408 + P P PP P PPP P PPPP P PP P Sbjct: 435 IAPLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLP 478 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P P PP P P PP P PP P Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGP 509 Query: 418 PL 413 PL Sbjct: 510 PL 511 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP-PPXXPXXXXPPPPXXPPP 414 P P PPP P P PP P P PP P P PP Sbjct: 450 PLPSDEPPPLP-PDEEKPPPPPAPALPPLPLPPELPGSPGDSPP 492 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = -1 Query: 536 PPLXPPP-XPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PPL PP P P P P PP P PP P Sbjct: 475 PPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPPLRQTP 515 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP P PPP P PPPP P P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP PPPP P PPPP P P PP Sbjct: 781 PTTPPPE-YPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 521 PPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPP 414 PP P PP P P P P PPPP PPP Sbjct: 859 PPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPP--PPP 894 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P P PPP P PP PP P PP Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P P PPPP P P PPPP Sbjct: 876 PGSPSVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPPP 913 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P PPP P PPPP P P P PPL P P Sbjct: 781 PTTPPPEYP--PPPPGLARPNPPP----PNPPLQVTSIPGEPAPP 819 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRG 534 GGGGGG GG GGG G GG RG Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 469 GGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGG GG GGGG G GG G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGG 508 R GGGGGG GG GGGG Sbjct: 999 RRRRGGGGGGGGGGGGGGG 1017 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 446 GXRGXXGGGGGGXGGXXGGGG 508 G G GGGGGG GG GG G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRG 1023 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 437 GGXGXRGXXGGGGGGXGGXXGG 502 GG G G GGGGGG G GG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXG 486 GGG GGGG G GG GG G Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGG 507 GGG G GGGGG GG G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGG 508 RG GGGGGG GG G G Sbjct: 1002 RGGGGGGGGGGGGGGGRRG 1020 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGG 477 G GGG GGGG G GG G Sbjct: 1005 GGGGGGGGGGGGGRRGGRGGARG 1027 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/53 (41%), Positives = 24/53 (45%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 E+ G G GG GGGG GGG G G GGG G G G +GG Sbjct: 1070 EQGGMGMPQMGGGGAAMGGGGQQPM-MMGGGQGMMMGNAMGGGMGGGMGMQGG 1121 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 GG GGG G G GGG G GG G G G Sbjct: 1109 GGGMGGGMGMQGGGMGMQGGGMGMQDGGMGMGDG 1142 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGG 537 G GGG G GGG G GG G GG G G G G Sbjct: 1105 GNAMGGGMGGGMGMQGGGMGMQGGGMGMQDGGMGMGDGMMQG 1146 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX------PPP-PPPXXPXXXXPPPPXXPP 417 P PP P P PPP PP PPP PPP PP PP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPP 292 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXP---PPPXXPPP 414 P PP P P PPP P PPP PPP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP--PPXXPPPXPXXXXKXP 387 PP PPP P PP PPP PP PP P P P Sbjct: 257 PPTKPPPRVASRRP--PPPLPPPDSSEAQAQQPPLSPPVGKPVVPAALMNRP 306 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 4/44 (9%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP----XPPPPPPXXPRXPXPPXP 430 P P PP PPPP PP PP P P P Sbjct: 256 PPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVP 299 >SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) Length = 723 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/59 (40%), Positives = 25/59 (42%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +KKG G GGG G G G G GG G G G GG G GG G G Sbjct: 430 KGDKDKKGSKRCGCGCGGGC-GCGCGDGYGYGGYGGYGGCGYGGYGGYGFPGGWGHGLG 487 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 542 PXPPLX-PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P P PP PP PP P P PP PP Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNP----PAPPTNPP 257 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 P + P P PP PP P P P P PP PP P K Sbjct: 209 PGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPK 258 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPP 436 P PP P PP PP PP PP P P P Sbjct: 222 PTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 524 PPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP P PP PP PP P PP P PP P Sbjct: 221 PPTTQTPPTKAPTDPPVPPTNPPVPP--TNPPAPPTNPPKP 259 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP P P P PP PP PP PP P PP P Sbjct: 227 PPTKAPTDP-PVPPTNPPVPPTNPPAPP--TNPPKP 259 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G GGGGGG GG G G G G G G G Sbjct: 242 GDGDGDGDGDGDGDGDGDGGGGGG-GGDGDGDGDGDGDGDGDGDG 285 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G G GGGGGG G G G G G G G G Sbjct: 244 GDGDGDGDGDGDGD-GDGGGGGGGGDGDGDGDGDGDGDGDGDGDG 287 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G GGG GGG G G G G G G G G G G G G G Sbjct: 258 GDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 303 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGGGXGXGGG 525 G GGG GGG G G G G G G G G G G G Sbjct: 327 GDGGGGDGGGDDGGDGDGDGDGDGDGDGDGDRDGDGDGDGDG 368 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G GGGGGG G G G G G G Sbjct: 246 GDGDGDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDG 289 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PPP P PPP PP P P P PP Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 PP PPP PP PPP P P P PP Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPP 417 PP P P P PPP PPP P P P PP Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -1 Query: 536 PPLX-PPPXPXPPPPXXPPXPPPPPPXXP 453 PPL PPP PPP P P PP P Sbjct: 433 PPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPP 436 P P PPP PP P P P P PP Sbjct: 424 PGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP P P P PP PP Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP PP P PPP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAP-PPPPNP 30 Score = 36.7 bits (81), Expect = 0.025 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXPP 418 PP PPPPPP PP P PP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 PP PPP P PP PPPPP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAP 32 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPP P PP P P P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNPAP 32 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 7/31 (22%) Frame = -1 Query: 524 PPPXPXPPP-------PXXPPXPPPPPPXXP 453 PPP P PPP P PP PP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPPPPP P P PPP P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = -1 Query: 542 PXPPLXPPPXPX----PPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PPP PP P PP P P P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAPDVPAESVNTQPNSQAAP 49 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P PP PP P PP P P P Sbjct: 7 PPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P PP PP PP PP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPP-PPNPAPDVP 35 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 PPPP P PPP P PP P P Sbjct: 5 PPPP--PPPPPIAAEFTAPPAPPPPPNPAP 32 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXP 430 PPPP PP P P P P P Sbjct: 10 PPPPIAAEFTAPPAPPPPPNPAPDVP 35 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GG GG G GG GG Sbjct: 57 GDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGG 99 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GG GG G GG GG Sbjct: 107 GDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGG 149 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 + G G GGG GG G GGG G G GG G G GG G Sbjct: 85 DDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGGVG 141 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +1 Query: 415 GGGXXGG---GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GG GG G G GG GG GG G GG GG Sbjct: 72 GFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGG 115 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 7/50 (14%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG-------GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGG G GG GGG G G GG G Sbjct: 114 GGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGSGVGGGDG 163 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GG GG GG G G GG G Sbjct: 65 GGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVG 107 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 GV GGG GG G G GGG G GGG Sbjct: 122 GVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGSGVGGG 161 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 GG GG G GGG GG GG G G GG G Sbjct: 82 GGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVG 124 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG-GXRGGXG 543 GG GG G GGG GG GG GG GG G Sbjct: 48 GGDDDSGGVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVG 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 25/96 (26%), Positives = 25/96 (26%), Gaps = 2/96 (2%) Frame = +3 Query: 297 GGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGG 476 GG N G G G G GG G G G GG Sbjct: 64 GGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGV 123 Query: 477 GGXGXXGGGG--XGXXXXXXGGXXGXGXXXXGXXXG 578 G G GGG GG G G G G Sbjct: 124 GDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGSGVG 159 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGG----GGXGGXXGGGG 508 GV GGG GG G G GG GG G G GG Sbjct: 55 GVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGG 98 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G G GG GGG GG G G GGG GG Sbjct: 338 GNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGG 378 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G GG G G G GG G GGG G GG G Sbjct: 351 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGG 392 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GG GGGG G GGGGG GG G GGG Sbjct: 354 GGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGG 390 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG GGGG GGGGG G G GG G Sbjct: 351 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGG 392 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG GGGGG G G GG G G Sbjct: 370 GGGGGYSGGGSGITWNQAGGGGGSY--CAGSSCKGVTGGNSGREG 412 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGX---GGXXGGGGX-GXGGG 525 G GG G GGGGGG G GGGG G G G Sbjct: 343 GYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSG 381 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG G G GGG G GGGG G Sbjct: 359 GGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAG 397 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GG GG G G G GG RGG G Sbjct: 195 GGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFG 239 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG G GG GG GG G GG G GG G Sbjct: 237 GFGGDFGGDGGRFDASNMGGATGGTGNMFGGVGGTAAGGQTG 278 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GG GG GG G G GG G Sbjct: 228 GGPRGGGRGGFGGDFGGDGGRFDASNMGGATGGTGNMFGGVG 269 Score = 28.7 bits (61), Expect = 6.7 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 8/63 (12%) Frame = +3 Query: 414 RGGXXXGXGGX-------GXGXXXGGGGGG-XGXXGGGGXGXXXXXXGGXXGXGXXXXGX 569 RGG G GG G G GGG GG G GG G GG G G Sbjct: 208 RGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFGGDFGGDGGRFDASNMGGATGGTGNMFGG 267 Query: 570 XXG 578 G Sbjct: 268 VGG 270 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PP P PP P PPP P P P P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P P P PP PPP P PR P P P Sbjct: 511 PTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAPCNP 551 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P PP PPP P PPP P P P P Sbjct: 527 PSPPA-PPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXP--XPPXPXXPPPXXXXXXXTPL 385 P PP PPPPPP + P P P P P+ Sbjct: 454 PQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPM 493 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P P P PP P PPP PPP Sbjct: 504 PCAPSCAPTYSPSCCGSYPAPQPPSPP---APPPKPAPPP 540 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P PP PP PPP PPP PP Sbjct: 511 PTYSPSCCGSYPAPQPPSPPAPPP-----KPAPPPRSPP 544 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP P PPP P P P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP 465 PPL P P P PP PP PP PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXP 453 PP P PPP PP PP PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP 468 P PPL PP P P PP PP P Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXP 430 PP P PP PP P+ P PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPP 417 PP PP PPP PP P PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXPP 418 PP PP PPP PP P PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP P PP PP P PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P P P P P PPPPPP PPPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPP-------PPPPPAPGSTP 394 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P P P P PPP PP PPP P P Sbjct: 365 PAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP P P P P PPP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP P P P P P P P PPP TP+ Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTPV 395 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P P PP P PPP Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP PPPPPP PP P P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPP-------PPAPGSTP 394 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P P P PPPPPP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPP---PPPAP 390 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +2 Query: 440 GXGXRGXXGGGGGGXGGXXGGGG 508 G G RG GGGGGG G GGGG Sbjct: 338 GSGDRGFLGGGGGGGGSSGGGGG 360 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G G G GGGGGG G GGGG G R Sbjct: 336 GDGSGDRGFLGGGGGGGGSSGGGGGRDDESGKR 368 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGG 506 G G G GGGGGG GGGG Sbjct: 336 GDGSGDRGFLGGGGGGGGSSGGGGG 360 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G G G GGGG G G GG Sbjct: 333 GSAGDGSGDRGFLGGGGGGGGSSGGGGG 360 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G GGGG G GG GG G Sbjct: 336 GDGSGDRGFLGGGGGG-GGSSGGGGG 360 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -1 Query: 536 PPLXP--PPXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP P PP P P P PPP P P P P PP P PF S Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAPFLS 565 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = -1 Query: 536 PPLXP--PPXPXPPPPXXPPXPPPPPPXXPXXXX--PPPPXXPPPXPXXXXKXPFFS 378 PP P PP P PP PP P P P P PP P PF S Sbjct: 201 PPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPPTAPFLS 257 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXP--XPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PP P P P PP P PP P PP P PP Sbjct: 174 PTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAP--SYPPTPSSYPP 216 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P PPP P P P P P P PP P Sbjct: 518 PTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPP--PPXXPXPPPPPPXXXPXPX--PPXPXXXPPLXXXXX 398 P P PP P P PP P PP P P P PP PP Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYN 229 Query: 397 XNXPFFP 377 P +P Sbjct: 230 PTAPSYP 236 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 533 PLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P PP P PP P PP P PP PP P Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYPPTQP--SYPPTAPSYPPTP 211 Score = 31.5 bits (68), Expect = 0.95 Identities = 22/76 (28%), Positives = 23/76 (30%), Gaps = 2/76 (2%) Frame = -1 Query: 542 PXPPLXPP-PXPXPP-PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXX 369 P P PP P PP P PP P PP P P PP P P + Sbjct: 181 PTQPFYPPTPSSYPPTQPSYPPTAPSYPP-TPSSYPPIAASYPPTAPSYNPTAPSYPPTP 239 Query: 368 FXXXPXXXXXXPXPXF 321 P P F Sbjct: 240 SSYPPTQPSHPPTAPF 255 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 PP P PP P P P P P PP TP Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTP 547 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP--PXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 P P PP PP P P P P P P P PP P F S Sbjct: 208 PPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPPTAPFLSSDTTFLS 264 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPP--PPXXPXPPPPPPXXXPXPX--PPXPXXXPPLXXXXXXNXPF 383 P PP P P PP PP P P PP P PP PF Sbjct: 198 PSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPPTAPF 255 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP---XPXPPXPXXXPPLXXXXXXNXPF 383 P PP P P P PPP P PP P PP PF Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAPF 563 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGGGGG GG GG G G GG G Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRG 534 GGG GG GG GGGG G G G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGG 3721 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 GG GGGG G GGGGGG G GG G Sbjct: 3698 GGGYGGGG----GGYGGGGGGYGDGTGGAAFG 3725 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG GGG G GGGG G G G Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 472 GGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG GG G G GGG G G Sbjct: 3698 GGGYGGGGGGYG-GGGGGYGDGTG 3720 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P PPPP PPPPPP PPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPPP P PPPPP PPPP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P PP P P PPPP PPPPP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 487 PXPPPPPPXXXPXPXPPXPXXXPP 416 P PPPP P P P PP PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPP 218 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP----XXPPPXP 408 P P P PPPPP P PPPP PPP P Sbjct: 182 PGSPTEDTPWTSVPPPPPP--GPGGIPPPPPPIRGGVPPPPP 221 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = -1 Query: 533 PLXPPPXPX---PPPPXXPPXPPPPPP 462 P PPP P PPPP PPPPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPPPXXPRXPXPP 436 P P PPP P PPPPPP P PP Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPP 220 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGGG G GG G G GGGG G RGG Sbjct: 37 GIAGGRMGGGGMAGEGMGRGGMAGEG--MGGGGMAGEGMGRGG 77 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G GGGG G GGG G G GG Sbjct: 137 GMAGEGMGGGGMAGEGM---GGGGMAGEGMGGGGIAGEGISGG 176 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 G G GG G G GGGG G GGGG GG Sbjct: 137 GMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGG 176 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G G GG G GGGG G RGG Sbjct: 57 GMAGEGMGGGGMAGEGM--GRGGMAGEGMGGGGMAGEGMGRGG 97 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G GGG G G G G G GG G G G G G GG G Sbjct: 62 GMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGG 107 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G G G GGGG G GGG G G GG Sbjct: 124 GRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGG 166 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G G GG G GGGG G RGG Sbjct: 77 GMAGEGMGGGGMAGEGM--GRGGIAGEGMGGGGMAGEGMSRGG 117 Score = 30.3 bits (65), Expect = 2.2 Identities = 24/92 (26%), Positives = 25/92 (27%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGG 470 G GG G G +G RGG G G G Sbjct: 84 GGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGM 143 Query: 471 GGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GGGG G GG G GG G G Sbjct: 144 GGGGMAGEGMGGGGMAGEGMGGGGIAGEGISG 175 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G G GG GG GGGG G RGG Sbjct: 21 GQHSRGGMAGEGM--GRGGIAGGRMGGGGMAGEGMGRGG 57 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +3 Query: 384 KGXFXXXXXXRGGXXX-GXGGXGX-GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 +G RGG G GG G G GGGG GGGG G G Sbjct: 125 RGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGGAIFG 180 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPPP P PPPP P PPP PPP P Sbjct: 75 PMMMPFPPPP--PIYMPPPPVYMP----PPPVYMPPPMP 107 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPX-XPPXPPPPPPXXPXXXXP 438 P PP PPP PPPP PP P PP P P Sbjct: 79 PFPP--PPPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX---PPXPXXPPP 415 P P PPPPP P P PP PPP Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPPVYMPPP 105 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPPP P PP P P PP P P Sbjct: 82 PPPPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -1 Query: 536 PPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP+ P P PP P PPP P PP PPP Sbjct: 273 PPIEHRPHHRPFPPAVHAPYHPPPAYSNP-TYQPPASTYPPP 313 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG-GGXRGG 537 GG GGGG G GG GG G G G G GG RGG Sbjct: 1270 GGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGG 1311 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG-GXRGG 537 G GG GGGGG G GGG G GG RGG Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGG 829 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGGG G GGG G GG GG GG G Sbjct: 804 GGGGGYNRGYGSGGGYGGGGYNKRGGRYSGGSNWG 838 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG----GGGXGXGGGXRGGXG 543 G GGG GGG GG G GG G GG +GG G Sbjct: 1249 GGGGGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYG 1297 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 436 GGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 GG G GGGG G GG G GG GG G G Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYG 1302 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G GG G G G G GGG Sbjct: 1274 GGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGG 1312 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX--PPXPPPPP--PXXPXXXXPPPPXXPPP 414 P P PPP P P P P PPPP P PPP P P Sbjct: 526 PVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAP 572 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP+ P P P PPPPP P P PPP Sbjct: 513 PPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPP 553 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP--XXPXXXXPPPP 429 P PP+ P P PP PP P P PPPP Sbjct: 514 PIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPP 553 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP--XPPXP 430 P P P P P PP PP P P P PP P Sbjct: 512 PPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPP 553 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG G GG G GG G G GGGG GGG Sbjct: 519 GGGAIGDGGDNGGGDDGGDDGA-GNSDGGGGNDNGGG 554 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G GGG G G G GG GG G Sbjct: 519 GGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G GGG G GG GGG G G G Sbjct: 504 GGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGG 547 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG--GXGXGGGXRGGXG 543 G GG G G GGG G GG GGG G G G G G Sbjct: 501 GAIGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGG 547 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGGG G GG G GG G G G Sbjct: 474 GCDGGGGANVGGDIGGNNGAIGGDNDDGAIGGDDG 508 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G GGG G G G GGG G Sbjct: 513 GDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGG 553 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G GGGG G GGGG G G G G G Sbjct: 435 GGIGDGAI---GGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVG 484 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG--------GXGXGGGXRGG 537 G G G GGGG G GGG G G G G G GGG G Sbjct: 436 GIGDGAIGGGGDGAIG--GGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVG 484 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGG GG GG GG G Sbjct: 474 GCDGGGGANVGGDIGGNNGAIGGDNDDG 501 >SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 36.7 bits (81), Expect = 0.025 Identities = 33/98 (33%), Positives = 34/98 (34%), Gaps = 5/98 (5%) Frame = +1 Query: 265 KGXXXXGXXGXXXK-KXXXXXXGXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGG 441 +G G G K K G G G K E KG G G G G G Sbjct: 4 EGEGEGGGEGKCKKGKDEGVCKGKGEGIKGEGEGQKG--EGKGEGIKDEGKGEGEGKGDG 61 Query: 442 XXXXGXXGGGGG-GXGGXXG---GGGXGXGGGXRGGXG 543 G G G G G G G GGG G G G GG G Sbjct: 62 KGEGGGKGEGEGKGEGKSEGKGEGGGKGDGKGEEGGKG 99 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 542 PXPPLX-PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P P P PPP P PPP P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP P P P P PPP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPPP PP P P P PPP Sbjct: 212 PPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPP-PPPXXPXXXXPPPP 429 + P P PP PP P PP P PPPP Sbjct: 204 IKPRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPP 238 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP 439 P PP PPP PPPP P + P P Sbjct: 212 PPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PPP PPP P P P P P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PPPP P PPP P P Sbjct: 206 PRSGPLPPTAAP--PPPPTTGAPPPTPVTNKPPPPRPATTQAPP 247 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPPP PP PP PPP PP Sbjct: 167 PGFAPPGNYPPPPAPPPAYPPVTQGYNMSQYPPPDVAPP 205 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 10/49 (20%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP----------PPXXPXXXXPPPPXXPPPXP 408 PPP P PPP PPP P P PPPP PP P Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYP 186 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP P P P PP P PP Sbjct: 140 PGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPP 183 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P P P P P P PPPP PPP P Sbjct: 330 PPSDSPSTTTPTTPQPPT--PTTPKTHPQLGPPPPPPPPPPTP 370 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP---PPPPXXPXXXXPPPPXXPPP 414 P P P PP P P P PPPP PPPP PPP Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPP------PPPPPTPPP 372 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 6/52 (11%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP------XPPPPPPXXXPXPXP 440 P P P P P PP P P PPPPPP P P P Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P P P P P PPPP PPP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPP 367 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P PP P P P PPPPPP P P Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTT--PKTHPQLGPPPPPPPPPPTPPP 372 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P P P P PP PP PPP PP Sbjct: 345 PPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P PP P P PP PPPPP P Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P PP P P P PP P PP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPP 368 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -3 Query: 507 PPPPXXPPXPP---PPPPXXPRXPXPPXPXXPP 418 PP P P P PPPP P PP P PP Sbjct: 345 PPTPTTPKTHPQLGPPPP-----PPPPPPTPPP 372 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG-GXRGGXG 543 G G G GG G G G GGG GG GGG G G G G G Sbjct: 7 GDGDGEGGGDGGDSGG--GSDGGGDGGDGGGGSDGGDGEGDDDGDG 50 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG GGGG GG G G G G G G Sbjct: 14 GGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDG 58 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G G GGG GG GGGG G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGG-DGGGGSDGGDGEGDDDGDG 50 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G G GG G G G G G G Sbjct: 18 GDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDGEG 60 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GGG G GGG G GG G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDG 48 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGG--GGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GG G GG GGG G GGG G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEG 52 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 379 EKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGG 489 EKKG G GG GG G GG GGG GG Sbjct: 278 EKKGSLVSLIGSAGGISASGGAGGSGGAGGVGGGGGG 314 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 454 GXXGG--GGGGXGGXXGGGGXGXGGGXRG 534 G GG GG GG G GG G GGG G Sbjct: 288 GSAGGISASGGAGGSGGAGGVGGGGGGTG 316 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GG GG G Sbjct: 288 GSAGGISASGGAGGSGGAGGVGGGGG 313 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GG G GG GG G Sbjct: 291 GGISASGGAGGSGGAGGVGGGGGGTG 316 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 GG GGG G G GG GG G GG G GGG G G Sbjct: 421 GGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSG 464 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG--XGXGGGXRGGXG 543 G GGG G G G GGG G G G GG G GG R G Sbjct: 425 GPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYG 471 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G GG GG GG G G G RG G Sbjct: 485 GGGYDDYYGGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGG 529 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 GGG G G G G GGG G G G GG Sbjct: 427 GGGYEGRGRGGRGGPRGGGPRGYDGGYGQGG 457 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXG-GGGGGXGXXGGGGXG 512 RGG G G G G G GGG G GG G G Sbjct: 423 RGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQG 456 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGG 525 G GG GGG G G GGG G GG G GGG Sbjct: 436 GGRGGPRGGGPRGYDGGYGQGGG-YEGYSGGYRDDYGYGGG 475 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 36.3 bits (80), Expect = 0.033 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGG 537 KG G G GG GG GG GG G GGG G GGG GG Sbjct: 232 KGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGG 284 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GG G GG G GG GGGG GGG R Sbjct: 247 GVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGGGLR 287 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGG---GGGGXGGXXGGGGX-GXGGGXRGGXG 543 GG GG G GG GG GGGG G GG GG G Sbjct: 233 GGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGG 279 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G K +G G GG GGG G G GGG Sbjct: 219 GGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGG 278 Query: 508 XGXGGG 525 G GG Sbjct: 279 GGYSGG 284 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG-GXRGG 537 GG G G GGGGG G G GG G GG Sbjct: 200 GGTAGNGATTADSNVSGGGGGGFYTDGQGSRNKGGSGGEGG 240 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGG 536 GGGGG G GGG G GG Sbjct: 262 GGGGGACGCNGGGAGGGGGYSGGG 285 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG GGG GG GG G G GGG RG Sbjct: 370 GRGGGRGGGRGGFRGGRG-GRGGGGRG 395 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG 504 GGG GG G G GG GG GG G G Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG 486 G GGG GG G G G GGGG G Sbjct: 370 GRGGGRGGGRGGFRGGRGGRGGGGRG 395 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G G GG G G RGG G Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGG 393 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 GG GGG G GG GG GG G G Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG 489 G GG GGG G GG GGG G Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGGGRG 395 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG---XXGGGGXGXGGGXRGGXG 543 G G GGGG GGGGG GG GG GG GG G Sbjct: 334 GTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGG 381 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GGGG GGGG GGG G Sbjct: 331 GGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGG 367 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGG------GGXGGXXGGGGXGXGGGXRGGXG 543 G GG G G GGG GG GG GGG GG G Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEG 374 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PPPP P P P P P P P PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP PP P P P PPP PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPP 162 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P P P P P P PP Sbjct: 124 PRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PPPP P P P P P P Sbjct: 115 PTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRP 166 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +1 Query: 382 KKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGGGXGXGGGXRGGXG 543 K G GGG G G GGGGG G GG G GG GG G Sbjct: 262 KGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAG 318 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 409 GXGGGXXGGGGXXXX--GXXGGGGGGXGGXXGGGGXG 513 G GG GGGG G GGGG GG GG G Sbjct: 283 GPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGG 319 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGGG GG GG G GG RGG G Sbjct: 377 GGGGGGLQFGNQDYTSRLSYGGGGGGG--GGSAFGIEGG-RGGHG 418 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG G GGGGG GG G G GG GG Sbjct: 378 GGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGRGGHGGG 420 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG GGG G G G GG GGG Sbjct: 261 GKGGDRNQPGNAGGGAGEGSTGGPGGINAGGG 292 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G G GG GGGGG G GG G G G Sbjct: 278 EGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYG 330 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 +GG G G G G GG G GGG G G G Sbjct: 262 KGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGG 307 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 8/52 (15%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGG--------XGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GGGG G GGGG GG G Sbjct: 273 GGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATG 324 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXPXPXF 321 PP PP PPP P PPP PP P P F+ F P P F Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPP--PDFSRPPPNFNDPAFQGRPPPFVRPPPQQF 332 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP---PPPPPXXPXXXXPPPPXXPPP 414 PP PP PPP PP PPP P PPP PP Sbjct: 285 PPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPP 328 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PP PPP P P P PPP Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPPP 303 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PP PP PP P PPP PP Sbjct: 270 PFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPP 309 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PP PPP P P PP Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPP 328 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP P PPP P PP PPP Sbjct: 270 PFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFP----PPDFSRPPP 310 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -1 Query: 533 PLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PL PPP PPP PP PP P PP PP Sbjct: 722 PLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPP 763 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 536 PPLXPPPXPXPPP----PXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPL PPP P P P P PPPPP P P P P P Sbjct: 681 PPLTPPP-PLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLP 733 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPP P P P P PP PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPP 734 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPX-PPXPXXPP 418 PP PPP PP PP P PP P PP Sbjct: 724 PPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPP 763 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = -1 Query: 542 PXPPLXPP-----PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXX-PPPXP 408 P PPL P P P PPPP P P PPPP P P Sbjct: 685 PPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPP 735 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -1 Query: 533 PLXPPPXPX----PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PL PPP P P P P PPPP PPP PP Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSL---PPPDESPP 740 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P P P PPPP P P P P Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHP 745 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPP 414 P PP PP P P P PPPP P PP PP Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPP 746 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP PP PP P P PP P Sbjct: 724 PPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPPSVSSAP 769 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P+ P P PP P PP P P PP P P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPP-------TPRPGPPTPRP 1387 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP P P P PP P P PP P P Sbjct: 1363 PTPPRPPTPRPRPPTPR--PGPPTPRP 1387 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -2 Query: 511 PXPPPPXXPXPP--PPPPXXXPXPXPPXP 431 P PPP P PP PPP P P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P+ PPP PP PP PP P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETP 1601 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 PP P P PPP PP P P P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P P P P P PP P PP TP Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPPPPXXP 453 P P P P PP PP P PP P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PP P PP P P PP P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTP-RPGPPTPRP 1387 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = -1 Query: 497 PXXPPXP-PPPPPXXPXXXXPPPPXXPPP 414 P PP P P PP P PP P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = -3 Query: 498 PXXPPXP-PPPPPXXPRXPXPPXPXXPPP 415 P PP P P PP P PP P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPPP P P PPP PP P Sbjct: 1575 PITPPPPTPSPPQT---PPPVNTPPRP 1598 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP PP P P P P P K P Sbjct: 1649 PVTPPTTDPPRPPVTVTPKPSTDAPLPASTSRPQPPVPTKLP 1690 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P P PP P P PP P P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTP-RPRPPTPRP-GPPTPRP 1387 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PP P PP P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPPP P PPP P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 35.5 bits (78), Expect = 0.058 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPP 465 P P PPP PP PPPPP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = -1 Query: 512 PXP-PPPXXPPXPPPPPP 462 P P PPP P PPPPPP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ P P PP P P PPP P P P P P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALP--STPTLPLAPRPRP 75 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPP 432 P PPL PP P P PPP P P P P P Sbjct: 43 PLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQP 80 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXPXXXXKXP 387 L PP P P P P PP P P P P P P P P Sbjct: 32 LAVPPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQP 80 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P P PP P P PPP P P P P P Sbjct: 36 PIPHGPRPLPPLREPPTPA--PTPPPALPSTPTLPLAPRP 73 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP PP P P PPP P P P P P Sbjct: 38 PHGPRPLPPLREPPTPA--PTPPPALPSTPTLPLAPRPRPTASQP 80 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG G G G G G G G G GG G GGG Sbjct: 239 GDGGGD-GDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGG 276 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG 480 G G G G G G GGGGGG Sbjct: 255 GDGDGDGDGDGDGDGGVGGGGGGG 278 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG G GGGG G G G GG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGG 159 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GG GGGG G GGGG GG G GG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGG 159 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGG G GG G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDG 150 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGGG G G G G GG G GG Sbjct: 129 GGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GG GG G GGGG G G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDG 158 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG G GGGG GG G G G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDG 158 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GG GG G G GG GG G G G GGG G Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGGXXG 544 GG G G G G GG GG GG GG G GG G Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG GG G GG GG G Sbjct: 424 GSSGGGFGGSSGGSFGGSSGGSFGGSG 450 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GG GG G GG G G G GGG R Sbjct: 424 GSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGGSR 464 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -3 Query: 507 PPPPXXPPXPPPPP--PXXPRXPXPP 436 P PP PP PPPP P P P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP PP PPPP P P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P PP PP P PP PP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -1 Query: 521 PPXPXPP--PPXXPPXPPPPPPXXPXXXXPP 435 P P PP PP PP P PPP P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPP--PNTPGPP 255 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP P P P PP PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = -3 Query: 507 PPPPXXPPXPP--PPPPXXPRXPXPPXP 430 P P P PP PPPP P P P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPP 465 P P P PP PP PPPP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPP 249 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPP 462 P P P P PPP P PP P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P P PPPP P P Sbjct: 227 PASPKPPTAPPNTP--PPPVTPPPPNTPGP 254 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PPP P P Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 G G G G G G G G G GGG G G G G GG G Sbjct: 213 GDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVG 258 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G G G G G G GGG GG G Sbjct: 210 GDGGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDG 250 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 417 GGXXXGXG---GXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G G G G G G G G GGG G G G G Sbjct: 212 GGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDG 260 >SB_504| Best HMM Match : GRP (HMM E-Value=2.8) Length = 107 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXX---GGGGGGXGGXX-GGGGXGXGG 522 GGG G GG GGGG G GG GGGG G GG Sbjct: 21 GGGSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGGDGCGG 60 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 8/35 (22%) Frame = +1 Query: 463 GGGGGGXGG--------XXGGGGXGXGGGXRGGXG 543 GGG G GG GGGG G GG GG G Sbjct: 21 GGGSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGG 55 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPP 468 PP P PPPP PP PPPP Sbjct: 74 PPQPTPPPP-RPPTPPPP 90 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXP 439 PP P PPPP P P P Sbjct: 74 PPQPTPPPPRPPTPPPP 90 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 480 PPPPPPXXPRXPXPPXP 430 PP P P PR P PP P Sbjct: 74 PPQPTPPPPRPPTPPPP 90 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +1 Query: 409 GXGGGXXGGG---GXXXXGXXGGGGGGXGGXXGGG 504 G GGG GGG G G GGGG G GG GG Sbjct: 56 GQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGG 90 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGX---GXGGGXRGGXG 543 G G GGGG GG G GG G GGG +G G Sbjct: 53 GVGGQGGGGQGGGQGVGGQEVGGQGGGGQGVGG 85 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -1 Query: 524 PPPXPXPPPPXX-PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P P PPP P PPP P P K P Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKP 972 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPXP---PPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PPP P P P P PP PP Sbjct: 942 PTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPP 987 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P + P P PPP P P PPP P P P Sbjct: 932 PEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKP 972 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXP 452 P PP P PPPPPP P Sbjct: 1915 PTPPREPTPPPPPPTPLP 1932 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P PPP P+ P PP P P P+ Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPI 973 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = -1 Query: 542 PXP-PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P P PL P P PP PPP P P P P Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSP 963 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 6/64 (9%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXP-----PPPP-PXXXPXPXPPXPXXXPPLXXXXXXNX 389 P P PP P PPP P P P P P PP P PP+ Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTP---PPVVSPHKQTR 996 Query: 388 PFFP 377 P P Sbjct: 997 PISP 1000 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 34.7 bits (76), Expect = 0.10 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPR 451 PPP PP PPPPPP R Sbjct: 211 PPPPPPPPPPPPPPMLAR 228 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP 439 PPPP PP PPPPP R P Sbjct: 211 PPPPPPPPPPPPPPMLARRWYYP 233 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -1 Query: 524 PPPXPXPPPPXXPP 483 PPP P PPPP PP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 511 PXPPPPXXPXPPPP 470 P PPPP P PPPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -1 Query: 536 PPLXPPPXPXPPPP 495 PP PPP P PPPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPP 462 P P PPPP PPPPPP Sbjct: 211 PPPPPPPP-----PPPPPP 224 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PPPPP PPPP PPP P F+ Sbjct: 211 PPPPP-------PPPPPPPPPMLARRWYYPAFT 236 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP-XPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP P P P PP PPP PP PP P Sbjct: 154 PPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGP 197 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP-PPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PP P PPP P PP P P P Sbjct: 124 PIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYP 169 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = -1 Query: 533 PLXPPPX--PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPP P PP P PP P PPP PP Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPP 155 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPPPPPXXPXXXXPPPPXXPP-PXP 408 P PP P P P P PP P P P PP PP P P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYP 164 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + PPP PP PP P P P P PP P P Sbjct: 142 PTASVYPPPGGYPPTSY-PPQPYPAQPYPQQGYPPQPPPQAYPQP 185 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXP--PPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PP P P P P PP PPP P P P P PP Sbjct: 149 PPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYP-PQGYPP 194 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP PP P PP P PPP PP Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPP 155 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPP P PP P P P P P Sbjct: 130 PYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPP 179 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPX--XPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP P P P P P PPP Sbjct: 104 PPTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPP 150 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPX--PXXPPP 415 PPP PP PP P P P P P PPP Sbjct: 148 PPPGGYPPTSYPPQPY-PAQPYPQQGYPPQPPP 179 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PPPP P PP P P P P Sbjct: 105 PTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHP 142 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PP P P P PP P P P Sbjct: 159 PPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGPYPQTQPGYAGATP 210 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 4/59 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP-XPPP---PPPXXXPXPXPPXP 431 P P P P P P P P P PPP PP P P P P Sbjct: 109 PVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQP 167 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 3/46 (6%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPPXXXPXPXPP 437 P P PP P P P PPP P P P PP Sbjct: 149 PPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPP 194 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPP---PPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P PP P PP PPP P P P PP P TP Sbjct: 154 PPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGPYPQTQPGYAGATP 210 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 6/45 (13%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-----GGGGXGGXXGGGGX-GXGGG 525 G GG GGGG GG GGGG G GGGG G GG Sbjct: 84 GGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGG-----GGGGXGGXXGGGGXXXXXXXGGXXG 544 GG G GG G GG GGGG G GGGG GG G Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVG 124 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG-GGGGGXGGXXGGGG-XGXGGG 525 G GG GG G G GGGG G GGGG G GG Sbjct: 79 GCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG GGG G G G G GGG G G Sbjct: 83 GGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEG 127 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G G G G GG G Sbjct: 76 GCGGCEGGGGSGGCEGG-GGCVGCEGGGGCVGCEGGGG 112 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGG G GGGG G GGG G GG Sbjct: 76 GCGGCEGGG--GSGGCEGGGGCVGCEGGGGCVGCEGG 110 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 6/61 (9%) Frame = -1 Query: 542 PXPPLXPPPXPXP----PPPXXP--PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFF 381 P P PP P P PP P PP P P P P PP P K P + Sbjct: 247 PTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHPTYKHPSY 306 Query: 380 S 378 S Sbjct: 307 S 307 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP P PP P PP P P P P PP P P Sbjct: 244 PPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIP 294 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PL P P P PP P P P P PP P P Sbjct: 236 PLIPNTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIP 284 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G G G G GG GG GG G G G G G G Sbjct: 19 GGGDRGRGRGHCLGH-GSGRGGRGG-RGGSGRGRGRGRGSGRG 59 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGGXG 543 G G G G G G G GG G G G G G G G G G G Sbjct: 24 GRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GG G G GG G G GGG GG Sbjct: 1041 GSGGGSGGSIIIHTRALEGSGTIATNGGNGNGDGGGGGGG 1080 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGG 506 G G G GG GGG G GG G Sbjct: 1687 GIGKGTEPGGSGGGHGGTGGRG 1708 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGG-GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG G GG G GG G G GG G Sbjct: 690 GDGQGEGGGGAGGRITVTYTRGGYHSSGTVANGGVGRSGSENGGPG 735 Score = 27.1 bits (57), Expect(2) = 0.17 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 463 GGGGGGXGGXXGGGG 507 G GGGG GG G GG Sbjct: 999 GSGGGGTGGKGGAGG 1013 Score = 25.4 bits (53), Expect(2) = 0.17 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG 489 G GG G G G G G GG GG Sbjct: 951 GWLGGDGEGAGSGSAGASGAGYGGRGG 977 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP P P P P PP P PPP Sbjct: 646 PPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPP 681 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPP----XPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P P P PP P P P PP P P Sbjct: 613 PSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYP 659 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPPXPPP--PPPXXPXXXXPPPPXXPP 417 P P PP PP P P P P P P PPP PP Sbjct: 640 PSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLPP 685 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXP-PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P PP P P PP PP P P P P Sbjct: 627 PKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKP 670 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPP 465 PPP PPPP PPPPP Sbjct: 197 PPPSGAPPPPPIGAPPPPPP 216 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 502 PPPXXPXPPPPPPXXXPXPXPP 437 PPP PPPPP P P PP Sbjct: 197 PPPSGA--PPPPPIGAPPPPPP 216 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPP---PPPP 462 P PPP PP PP PPPP Sbjct: 192 PSWNRPPPSGAPPPPPIGAPPPP 214 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P+ P P P P PP PPPPP P PP P Sbjct: 724 PVPPTPLVQHPEPEAPPQLPPPPPFI-VDDTESPQEQPPTTP 764 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P PP PPP P Sbjct: 722 PHPVPPTPLVQHPEPEAPPQLPPPPP 747 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PP P P PP P PPPP Sbjct: 722 PHPVPPTPLVQHPEPEAPPQLP----PPPP 747 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G G G G G G G G G GGG G G Sbjct: 769 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGAGAGDGGGDGDGDG 813 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G G G G G GGG G G G G G G Sbjct: 785 GDGDGDGDGDGDGDGAGAGDGGGDGDGDGDGDGDGDGAG 823 >SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 469 GGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGG GG G GG G GG G G Sbjct: 20 GGGGLGGSGGSGGSGGSGGSSGQTG 44 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRG 534 GGG GG GG G GG G G G Sbjct: 21 GGGLGGSGGSGGSGGSGGSSGQTG 44 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXG 499 GGG G GG G G GG G G G Sbjct: 21 GGGLGGSGGSGGSGGSGGSSGQTGDKDG 48 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP P PP PPPPP P PPP Sbjct: 196 PTRPPP-PLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPP 234 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PPPP PPPP PP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPP 217 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PPP PPPPPP PPP P Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPP 234 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 10/43 (23%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP----------XPPPPPPXXPR 451 P PP PPPP PP PPPPPP R Sbjct: 196 PTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPPKESR 238 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXP-PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PPP P P PP PPP P P P Sbjct: 580 PAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPP 632 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P PP P P PP P PPP P P Sbjct: 580 PAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYP 625 >SB_15136| Best HMM Match : Peptidase_S13 (HMM E-Value=0.27) Length = 638 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G G G G GG G G G G G G G G Sbjct: 536 GDGGGEGNGDGYEDVGDGDDDGAGDGGGDGDGDGYEGVGDGNGDSDGDG 584 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG G G G G GGG G G G G Sbjct: 534 GDGDGGGEGNGDGYEDVGDGDDDGAGDGGGDGDGDGYEG 572 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = -3 Query: 507 PPPPXX--PPXPPPPPPXXPR 451 PPPP PP PPPP PR Sbjct: 238 PPPPYTSLPPDDPPPPYDEPR 258 Score = 26.2 bits (55), Expect(2) = 0.21 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPP 471 P P P PP P PP PP Sbjct: 187 PAPGDPGAPEPPEPDNPPASPP 208 Score = 26.2 bits (55), Expect(2) = 0.21 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPP 417 PPPPP PPPP P Sbjct: 237 PPPPPYTSLPPDDPPPPYDEP 257 Score = 25.4 bits (53), Expect(2) = 1.0 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPP 462 L P P P P P PP PP Sbjct: 186 LPAPGDPGAPEPPEPDNPPASPP 208 Score = 24.6 bits (51), Expect(2) = 1.0 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPP 414 PPPPP PPP P Sbjct: 237 PPPPPYTSLPPDDPPPPYDEP 257 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/20 (65%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = -3 Query: 507 PPPPXXPPXPPPP--PPXXP 454 PPPP PP PPPP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP 474 P PPP P PPPP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPPPPP PPPP PP P Sbjct: 142 PPPPPPPP------SPPPPCHPPALP 161 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXP 445 PPP PP PPPP P P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPP 462 PP P PPP PP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXP 453 P PPPP P PP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPP 465 PPP P PP P P PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXP 453 P P PPP PP PPPP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP 483 P PP+ PPP P PPPP P Sbjct: 464 PPPPMSPPP-PTPPPPATSP 482 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPP 468 P+ PPP PPPP PP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPP 465 PPP P PPP PP P P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 478 PPPPPXXXPXPXPPXPXXXP 419 PPPPP P P PP P P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPP 417 PPPPP P PPPP P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXP 446 P PPPP PPP PP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP-XPPPPPPXXP 453 PP PP P PP PP PP PP P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDP 54 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 PP P PP PP PP P PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PP PP P P P PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPP 471 PP PP P PP PP PP Sbjct: 34 PPTDPPTDPPTDPPTDPPTDPP 55 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P PP PP P P P PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PP PP P Sbjct: 26 PPTDPPTDPPTDP--PTDPPTDPPTDPPTDP 54 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P PP PP P P P Sbjct: 27 PTDPPTDPPTDPPTDPPTDPPTDPPTDP 54 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-PPXPPPPPP 462 PP PP P PP P PP PP Sbjct: 30 PPTDPPTDPPTDPPTDPPTDPPTDPP 55 >SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 309 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 10/51 (19%) Frame = -1 Query: 542 PXPPLXPP-PXPXPP---------PPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PPL P P PP PP P P P PP P P PP P Sbjct: 184 PYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRRP 234 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP-PXP 408 P P P P PP P P PP P PP P P P Sbjct: 174 PGQPSPEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHP 217 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P P P P PP P P PP P P P P Sbjct: 208 PPRRPEYPHPYPPRRPEYAHPYPPRRPEYAHPFLPLPP 245 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 507 PPPPXXPPXPPPPPP 463 PPPP PP PPPP P Sbjct: 31 PPPPSPPPSPPPPSP 45 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 506 PPPPXXPPXPPPPPP 462 PPPP PP PPPP P Sbjct: 31 PPPPSPPPSPPPPSP 45 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 507 PPPPXXPPXPPPPPP 463 PPPP PP PPPP P Sbjct: 154 PPPPSPPPSPPPPSP 168 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 506 PPPPXXPPXPPPPPP 462 PPPP PP PPPP P Sbjct: 154 PPPPSPPPSPPPPSP 168 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPP 474 PP P PPP PP PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPP 474 PP P PPP PP PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXP 452 P PP P PPP PP P Sbjct: 31 PPPPSPPPSPPPPSPPLDCP 50 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXP 452 P PP P PPP PP P Sbjct: 154 PPPPSPPPSPPPPSPPLDCP 173 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P P P P P P P PPPPPP Sbjct: 67 PGQPQVTPQTPSPASPGLPFMPPPPPP 93 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-----PPXXPPXPPPPPPXXPXXXXPPPP 429 P + PPP P P P P P P P P PPPP Sbjct: 51 PQMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPP 93 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + PP P P P P P P P P P PPP P Sbjct: 51 PQMGMPPPPGPGQPEMP-GQPQVTPQTPSPASPGLPFMPPPPP 92 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P P P P PPPPP Sbjct: 59 PGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPP 92 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 507 PPPPXXPPXPPPPPP 463 PP P PP PPPPPP Sbjct: 163 PPQPPPPPLPPPPPP 177 Score = 33.5 bits (73), Expect = 0.23 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 506 PPPPXXPPXPPPPPP 462 PP P PP PPPPPP Sbjct: 163 PPQPPPPPLPPPPPP 177 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPP 471 P P PPPP PP PPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPP 474 PPP P PPPP PP PP Sbjct: 162 PPPQP-PPPPLPPPPPP 177 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP 483 PP PPP P PPPP PP Sbjct: 162 PPPQPPPPPLPPPP--PP 177 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -1 Query: 503 PPPXXPPXPPPPPP 462 PPP PP P PPPP Sbjct: 162 PPPQPPPPPLPPPP 175 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP 495 P P PPP P PPPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXP 453 PP PP PP PPP P Sbjct: 162 PPPQPPPPPLPPPPPP 177 >SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) Length = 391 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + PPP PPP PP P PPP PP Sbjct: 286 PPVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPP 328 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + PPP PPP PP P PPP P Sbjct: 293 PPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQP 335 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 G G GG G G GG GG GGG G G G G G G Sbjct: 739 GDGEYNYHGGDDDGDGDGDGDGGSNGGGDGGGDGDGDGDGDGDGDG 784 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GGG G G G G G GG G Sbjct: 761 GSNGGGDGGGDGDGDGDGDGDGDGDGEYNDDGGDDDG 797 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G G GG GG G G G G G G G G Sbjct: 747 GGDDDGDGDGDGD--GGSNGGGDGGGDGDGDGDGDGDGDGDG 786 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGG 525 G GG G GGG G GGGG G GGG G GG Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 437 GGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GGGG G GGGG GG G Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDG 138 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG-GGGXGXGGGXRGG 537 GGG G G G GG G G GG G G GG Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGGG G GGGG G GG Sbjct: 98 GSNGGGG---DDDGSNGGGGDDDGSNGGGGDDDGSNGGGG 134 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP+ P P P PP P P PP P P P P S Sbjct: 874 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSS 926 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP+ P P P PP P P PP P P P P S Sbjct: 890 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPLPGNQVNPPMSS 942 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP+ P P P PP P P PP P P P P S Sbjct: 906 PPMSSQPQPPPGNQVNPPMSSQPQPLPGNQVNPPMSSQPQPPPGNQVNPPMSS 958 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP+ P P P PP P P PP P P P P S Sbjct: 922 PPMSSQPQPLPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSS 974 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP+ P P P PP P P PP P P P P S Sbjct: 938 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSS 990 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP+ P P P PP P P PP P P P Sbjct: 954 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 996 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPP 414 P P P P P PP PP PP P P P PPP Sbjct: 161 PTTKPTPAPHSSPSPTPPPPPIIPPCPPVINLLIPTARPCMPPP 204 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P P P P P PPPPP P P PP Sbjct: 155 PTTTKKPTTKPTPAPHSSPSPTPPPPPIIP----PCPP 188 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPF 383 P P PP P PP PP P PP+ + PF Sbjct: 173 PSPTPPPPPIIPPCPPVINLLIPTARPCMPPPIIIHHHHHHPF 215 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PPPP PP P Sbjct: 155 PTTTKKPTTKPTPAPHSSPSPTPPPPPIIPPCP 187 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P PPPP PP P Sbjct: 165 PTPAPHSSPSPTPPPPPIIPPCPP 188 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG--XGGXXGGGGXGXGGG 525 G G GG G GG GGG G GGGG GGG Sbjct: 258 GMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGG 298 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G GG G G G GG G GGG G Sbjct: 270 GAVGGFGGWGGGSEDNGASGGGGGYSGGGSG 300 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGGGGXGGXXG 498 G GG G GGG G GGGGG GG G Sbjct: 270 GAVGGFGGWGGGSEDNGASGGGGGYSGGGSG 300 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GGG G G Sbjct: 254 GKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGG 298 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXG 512 GG G G GGG GG G GGG G Sbjct: 186 GGGGGGTTGGGGSGGEGTTGGGVSG 210 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGG 537 GGGGGG G G GG G GG G Sbjct: 186 GGGGGGTTGGGGSGGEGTTGGGVSG 210 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 471 GGGGXGXXGGGGXGXXXXXXGGXXG 545 GGGG G GGGG G GG G Sbjct: 186 GGGGGGTTGGGGSGGEGTTGGGVSG 210 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG 480 G GGG GGGG G GGG G Sbjct: 187 GGGGGTTGGGGSGGEGTTGGGVSG 210 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 GGGG G GGGG G G GGG G Sbjct: 186 GGGGG---GTTGGGGSGGEGTTGGGVSG 210 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P PP P PP P P PP PP Sbjct: 3810 PGPQGPPGQASQIPGPPGPQGPPGPPGPP 3838 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P PP P P PP P PP Sbjct: 3797 PGPPGRSKNISGPPGPQGPPGQASQIPGPPGPQGPPGPPGPP 3838 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP P PP P P PP P PP Sbjct: 3797 PGPPGRSKNISGPPGPQGPPGQASQIPGPPGPQGPPGPPGPP 3838 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PP P P P P P P P P P P Sbjct: 146 PNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAP 197 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PP P PP PP P P P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPP--QPETVPPQPGSEEPEPVSQAPEP 189 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P PP P P P P PP P Sbjct: 158 PPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGG 537 GGGGG GG GGG G G G G Sbjct: 86 GGGGGDGGGGGDGGGDGDGDGDGDG 110 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 454 GXXGGGG-GGXGGXXGGGGXGXGGG 525 G GGGG GG GG GG G G G G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDGDGDG 108 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGGG GGGGG GG G G G G Sbjct: 84 GDGGGGG------DGGGGGDGGGDGDGDGDGDG 110 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 487 GXXGGGGXGXGGGXRGGXG 543 G GGGG G GGG GG G Sbjct: 84 GDGGGGGDGGGGGDGGGDG 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 472 GGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG GGGG G GGG G G Sbjct: 84 GDGGGGGDGGGG-GDGGGDGDGDG 106 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGGG G G G G G Sbjct: 84 GDGGGGGD-GGGGGDGGGDGDGDGDG 108 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXG 486 GGG GGGG G G G G G Sbjct: 87 GGGGDGGGGGDGGGDGDGDGDGDG 110 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 PPPP P PPPP P P PP Sbjct: 794 PPPPPPPPPPPPEDLIIPLPRRGSDLFAPP 823 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 + PPP P PPPP P P PP Sbjct: 792 ITPPPPPPPPPPPPEDLIIPLPRRGSDLFAPP 823 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G G G GGG GG GG GGGG G G Sbjct: 406 GLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQG 439 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GGG GG G Sbjct: 409 GEEGSPSVFLGGGGRGGGGGDGGGGG 434 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 R G G GG GGG G GGGG G Sbjct: 404 REGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEG 436 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Frame = -1 Query: 533 PLXPPPXPXPPPP----XXPPXPPPPPP 462 P+ P P PPPP P PPPPPP Sbjct: 578 PVATSPPPHPPPPAHHVNKPGVPPPPPP 605 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PP PPPP P P P PPP Sbjct: 563 PTPSQTQVKYMGSTSPVATSPPPHPPPPAHHVNKPGVPPP--PPP 605 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPP 471 PP PPP P PP PPP Sbjct: 584 PPHPPPPAHHVNKPGVPPPPPP 605 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 PP P P P PPP PR P P P PP Sbjct: 405 PPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP---XPPPPPPXXPXXXXPPPPXXPPPXP 408 P + PP PP P PP PPP P P P PP P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = -1 Query: 518 PXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P PP P PP P P PP P P P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP--PPXXPRXPXPPXPXXPP 418 P P PP PP P PPP PP P P P P P Sbjct: 406 PRPMGPPGPHG-----PPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = -1 Query: 536 PPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPP--PXXPPP 414 PP PP P P P PP P P PP P PPP Sbjct: 382 PPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPP 426 >SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) Length = 447 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP PP PP PP PP P PP PP Sbjct: 295 PPYNAPPFTGQPPYNAPPFNGQPPYNTPPFNGQPPYYTPP 334 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP P PP PP PP P PP PP Sbjct: 284 PPYNNPLFTGQPPYNAPPFTGQPPYNAPPFNGQPPYNTPP 323 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP PP PP PP PP P P PP Sbjct: 306 PPYNAPPFNGQPPYNTPPFNGQPPYYTPPFNGQPLYHTPP 345 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP PP PP PP P P PP PP Sbjct: 317 PPYNTPPFNGQPPYYTPPFNGQPLYHTPPFNGQPPYNTPP 356 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXP 354 PP PP PP PP P PP PP P + F P Sbjct: 295 PPYNAPPFTGQPPYNAPPFNGQPPYNTPPFNGQPPYYTPPFNGQPLYHTPPFNGQP 350 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P PPP PPPP P P P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP 477 P PP PPP P PP P P Sbjct: 304 PPPPQTPPPPQTPAPPQTPAPP 325 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXP 430 P PP PPPP P P P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPP 414 P PPPP P P PP P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 P PPP PPP P P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPP 437 P PPP PPP P P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = -3 Query: 489 PPXPPPPP-PXXPRXPXPPXPXXPP 418 P PPPP P P+ P PP PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P+ PP PP P PP PPP P Sbjct: 143 PVSSPPRTPPPEPTPPPTPPPLRP 166 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP 477 PP PPP P PPP P P Sbjct: 147 PPRTPPPEPTPPPTPPPLRP 166 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXP 453 P P PP P PP PPP P Sbjct: 143 PVSSPPRTPPPEPTPPPTPPPLRP 166 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXP 430 P PP PPP P P P P P Sbjct: 143 PVSSPPRTPPPEPTPPPTPPPLRP 166 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG----GGXRGGXG 543 G GG GG G G GG GG G GG G GG GG G Sbjct: 177 GFPGGMPGGMPGGMPGGFPGAGGMPGGFPGAGGMPGGFPGAGGMPGGPG 225 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGG GGGG GG G G GG Sbjct: 216 GWENGGFGGGGSAMAHPGGGGGYSGGGIEGSETTGSAGG 254 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GG G G GGGG GGGG GGG G Sbjct: 212 GGKGGWENGGFGGGGSAMAHPGGGGGYS-GGGIEG 245 >SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1391 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG G GG G GG G G GG G G G G Sbjct: 1130 GDGGNGDGDGG----NGDGDGGNGDGDGDGGNGDGDGDG 1164 >SB_11360| Best HMM Match : PDZ (HMM E-Value=0) Length = 625 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P P PP P P P P PP P P Sbjct: 114 PSPPTLPKQTPPPPTPEVIETAPSPSPGENGEVNHVPPESPVP 156 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGGG G GGGG GG G GG G Sbjct: 163 GDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGGG 205 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGG-----GXGGXXGGGGXGXGGGXRGGXG 543 G GGGG G GGGG G GGG G GG G Sbjct: 20 GDDAGGGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGG 67 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGG----XGGXXGGGGXGXGGGXRGGXG 543 GGGG G GGGGG GGGG G G G Sbjct: 142 GGGGSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGG 183 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGG---XGGXXGGGGXGXGGGXRGG 537 G GGGG G GGGG G GGG G GG Sbjct: 150 GDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGG 193 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGG---XGGXXGGGGXGXGGGXRGGXG 543 G GGGG G GGGG G GGGG G G Sbjct: 72 GDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGG 117 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGG G GGG G GGG G G G Sbjct: 181 GGGGSDDDGDDGGGSYDDGDDGGGGDDDDYDGDDDGGG 218 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGGG G GGGGG G G GG G Sbjct: 90 GGGGSDHDGYDAGGGGG-SDDDGYDAAGGGGSDHDG 124 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 430 GGGGXXXXGXX--GGGGGGXGG--XXGGGGXGXGGGXRGGXG 543 GGGG G GGGG G GGGG G GG G Sbjct: 64 GGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGG 105 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP---XXPPP 415 PP PPPP PPPP P PP PPP Sbjct: 560 PPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPP 602 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 PP PPPP PPPP PP P Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = -1 Query: 524 PPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPP 429 PPP PPP PPPP PPPP Sbjct: 570 PPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP---XXPPPXPXXXXKXP 387 PP PPPP PPP PPPP PP P + P Sbjct: 537 PPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGP 589 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPPP PPPP PPP Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 528 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPPP PPPP PPP Sbjct: 526 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP 561 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG--XGXGGGXRGGXG 543 G G G G GG G G GG GG G GG G G G GG G Sbjct: 39 GGGHGG-GHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGG 84 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 27.1 bits (57), Expect(2) = 0.51 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P P P PPPP P PPP P Sbjct: 2054 PSASNPSPVPPPP--PSVPPPSLP 2075 Score = 23.8 bits (49), Expect(2) = 0.51 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPP 429 PP P PP PPPP Sbjct: 2111 PPPPLPPGDGYEFQGVPPPP 2130 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P PP P P P P P PP P P P Sbjct: 1329 PPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPP 1366 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPP--PPP 462 P P L PP PPP P PPP PPP Sbjct: 1343 PLPRLPLPPLRLPPPHSRLPLPPPKLPPP 1371 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -1 Query: 533 PLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PL P P P P P P PPP P PPP PPP Sbjct: 1334 PLPPSGLPLPLPRLPLPPLRLPPPHSRLPL----PPPKLPPP 1371 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -1 Query: 533 PLXPPPXPXPP---PPXXPPXPPPPPPXXPXXXXPPP 432 PL P P PP PP P PPP P P P Sbjct: 1341 PLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIPLP 1377 >SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGGGG G G G G G G G G Sbjct: 13 GGGGGGGDGDGDGDGDGDGDGDGDGDG 39 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGGGG GG G G G G G G G Sbjct: 12 GGGGGG-GGDGDGDGDGDGDGDGDGDG 37 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GGG G G G G G G G G G G Sbjct: 12 GGGGGGGGDGDGDGDGDGDGDGDG---DGDGDGDGDG 45 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG G GGG G GG G G G G G G Sbjct: 132 GGGPGYGGDYGGGLGHCGGPGHGHGPGHGHGHGAG 166 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GG G GG GG GG G G G GG Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG G GG G G GG G GG GG Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXG 513 GG GG G GG GG GG GGG G Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 GG GG G GG GG GG GG Sbjct: 297 GGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 PPP P PPP PP P P P P TP Sbjct: 179 PPPLNPYQPPPFPPPHLMYPQPTAPPAAIPRAKAKVQTP 217 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPPPPPXXP 453 PPL P P P PPP P P PP P Sbjct: 180 PPLNPYQPPPFPPPHLMYPQPTAPPAAIP 208 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 PPP P PPP PP P P P P P K Sbjct: 179 PPPLNPYQPPPFPP--PHLMYPQPTAPPAAIPRAKAK 213 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P P P P PPP P P P Sbjct: 168 PMGAPMGMCCMPPPLNPYQPPPFPPPHLMYPQPTAP 203 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP 438 + PP P PPP PP P P P P Sbjct: 178 MPPPLNPYQPPPFPPPHLMYPQPTAPPAAIP 208 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGG 508 RG GGGGGG GG GGG Sbjct: 163 RGGGGGGGGGGGGGRRGGG 181 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGG 522 GGGGGG GG GGGG GG Sbjct: 164 GGGGGGGGG--GGGGRRGGG 181 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 466 GGGGGXGGXXGGGGXGXGGG 525 GGGGG GG GGGG GGG Sbjct: 164 GGGGGGGG--GGGGGRRGGG 181 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 487 GXXGGGGXGXGGGXRGG 537 G GGGG G GGG RGG Sbjct: 164 GGGGGGGGGGGGGRRGG 180 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXG 512 G GGGGGG G GGG G Sbjct: 158 GRNRRRGGGGGGGGGGGGGRRG 179 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGG 508 RG GG GGG GG GGGG Sbjct: 150 RGRGGGRGGGGGGCGGGGG 168 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGG GG GGGG G GGG Sbjct: 147 GSVRGRGGGRGG--GGGGCGGGGG 168 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P PPPP P P PP P Sbjct: 138 PPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPLP 170 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP P PPPP P P PPL Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPL 169 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 PL PPP P P PPP PP Sbjct: 145 PLPPPPAQQEAVPDIPTSPPPVPP 168 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P PPPP P P PPP P Sbjct: 137 PPPPAKEAPLPPPP-AQQEAVPDIPTSPPPVP 167 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX--PPXPPPPPPXXPXXXXP 438 P PP P P PP P P PPP P P Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPLPTEP 173 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 PP P PPPP P P P P PP P Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIP-TSPPPVPPLP 170 >SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) Length = 398 Score = 27.1 bits (57), Expect(2) = 0.57 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P P P PPPP P PPP P Sbjct: 303 PSASNPSPVPPPP--PSVPPPSLP 324 Score = 23.8 bits (49), Expect(2) = 0.57 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPP 429 PP P PP PPPP Sbjct: 360 PPPPLPPGDGYEFQGVPPPP 379 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 25.4 bits (53), Expect(2) = 0.62 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 498 PXXPPXPPPPP 466 P PP PPPPP Sbjct: 2121 PGPPPAPPPPP 2131 Score = 25.0 bits (52), Expect(2) = 0.62 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 489 PPXPPPPPPXXP 454 PP PPPPP P Sbjct: 2123 PPPAPPPPPVQP 2134 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPP P P P P P P Sbjct: 282 PSPQPTEAKPHTPPPPTSTPPTTAPRQPSPMAPAPVQKESPP 323 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P P P P P PP Sbjct: 282 PSPQPTEAKPHTPPPPTSTPPTTAPRQPSPMAPAPVQKESPP 323 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXP--RXPXPPXPXXPPP 415 P P P PPPP P P P P P P Sbjct: 284 PQPTEAKPHTPPPPTSTPPTTAPRQPSPMAPAP 316 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PP P PPP P P P P P PP Sbjct: 628 PRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPP 665 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 8/58 (13%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXP----XPPXP----XXPPPXXXXXXXTPL 385 PP P P PP PP PPP P P P PPP TPL Sbjct: 619 PPHLQSTAQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATPL 676 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP----PXXP----PXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP PPP P P P PPP P PPP Sbjct: 635 PLPPTPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATPLPRLATHPPP 685 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PPP PP PPP P P P P P Sbjct: 170 PPPEILPPTAPPPQPAPAISPSAPAISPPAP 200 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP PP PPP P P P PP P Sbjct: 170 PPPEILPPTAPPPQP--APAISPSAPAISPPAP 200 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = -1 Query: 536 PPLXPPPXPXPP-PPXXPPXPPPPPPXXP 453 PP PPP P P P P PP P P Sbjct: 176 PPTAPPPQPAPAISPSAPAISPPAPVFIP 204 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P P P P P P P P P P P P P Sbjct: 254 PEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEPVHVP 298 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P P P P P P P P P P Sbjct: 250 PVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEP 292 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P P P P P P P P P P P P P Sbjct: 264 PEPEQEPEPEPEPEPEPEPEPEPEPEPEPEPVHVPEP 300 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P P P P P P P P P P P Sbjct: 242 PAKLPPRQPVAEPEPERQPEPEPEPEQEP-EPEPEPEPEPEPEP 284 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 5/44 (11%) Frame = -1 Query: 524 PPPXPXP---PPPXXPPXPP--PPPPXXPXXXXPPPPXXPPPXP 408 PPP P PP PP P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEP 274 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P P P P P P P P P Sbjct: 260 PEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEP 294 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P P P P P P P P P P Sbjct: 260 PEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEPVHVPEP 300 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPP 462 P P P P PP PPP PP Sbjct: 161 PKPADPAPMQPPAPPPSPP 179 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 497 PXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP P PPP P PPP P Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPPARP 388 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXP 453 PPP P PPP P PPP P Sbjct: 365 PPPPPHSPPPPLPVIQLNPPPARP 388 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXP 430 P PP P PPPP P P P P Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPPARP 388 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 477 PPPPPXXPRXPXPPXPXXPPP 415 PPPPP P P P PPP Sbjct: 365 PPPPPHSPPPPLPVIQLNPPP 385 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPP 462 P PP PPP PPP P PPP P Sbjct: 363 PTPP--PPPHSPPPPLPVIQLNPPPARP 388 >SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG--XGGXXGGGGXGXGGGXRGG 537 G GGG G GG G G G G GG G GG GG Sbjct: 497 GSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSGGGGASGGRGGG 541 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PP PPP PPPP P PPP Sbjct: 53 PPAGGYPPPQPGYAGGPPPPGIAPGIGGPPP 83 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P P P PP P PP PP PPP P Sbjct: 23 PPAAPGGYP-PAPGGYPPAPGGYPPSG-GYGYPPAGGYPPPQP 63 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXPP 417 P P PP P PP PP PPP PPPP P Sbjct: 31 PPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAP 76 >SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) Length = 242 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P+ P P P P P P P P P P P P P P Sbjct: 57 PHDPITPRPHRPTAPRPHDPIAPRPRSPHGPVAPRPHRPISPRP 100 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + P P P P P P P P P P P P P Sbjct: 52 PTIPSPHDPITPRPHRPTAPRPHDPIAPRPRSPHGPVAPRP 92 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P P P P P P P P P P P P P PP Sbjct: 65 PHRPTAPRPHDPIAPRPRSPHGPVAPRPHRPISPRPHRPTTPP 107 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P P P P PP P P P P P Sbjct: 17 PTAPRPHRPIAPSPLGPTTPSPPSHHGPISLRPHRPTIPSP 57 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GG GGGG G G GGG G Sbjct: 556 GGGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDG 597 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G + G G G G GG G G GG GG G Sbjct: 566 GDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGGDDDYNGGDG 625 Query: 508 XGXGG-GXRGGXG 543 GG G G G Sbjct: 626 DSNGGDGGDNGTG 638 Score = 28.3 bits (60), Expect = 8.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG GGGGG G G GG GG G Sbjct: 557 GGGGGDYNGGDGDDDD--GGGGGDDDDGDGDGDDDDDGG--GGDG 597 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPPP PPPP P PP P Sbjct: 99 PDTDVPPPPATTSAPPPPTTTAPPATTSPPTTTDSP 134 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP PPP P PP PP Sbjct: 96 PAQPDTDVPPPPATTSAPPPPTTTAPPATTSPPTTTDSPP 135 >SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) Length = 687 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPXPPXP 430 P P PP PP P+ P PP P Sbjct: 7 PLVPKAPPEQPPPAPKEPKPPKP 29 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP 439 P P PP PPP P P+ P P Sbjct: 7 PLVPKAPPEQPPPAPKEPKPPKP 29 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P P PP P PP P PP P P PP P P + P+ Sbjct: 333 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPY 383 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 326 PYEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 375 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 340 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 389 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 347 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 354 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPP 403 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 368 PHEPGRPPHEPGRPP--YEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLP 417 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/77 (27%), Positives = 22/77 (28%), Gaps = 4/77 (5%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPP--PPXXPXPPPPPPXXXPXP--XPPXPX 428 P P P P PP P P PP P PP P P PP Sbjct: 319 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 378 Query: 427 XXPPLXXXXXXNXPFFP 377 PP + P P Sbjct: 379 GRPPYEPGRPPHEPGRP 395 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPP--PXXPPPXPXXXXKXP 387 PP PP P PP P P PP P PP P P Sbjct: 318 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 364 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 336 PGRPPHEPGRP-PHEPGRPPHEPGRPPHEPGRP-PHEPGRPP 375 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 343 PGRPPHEPGRP-PHEPGRPPHEPGRPPHEPGRP-PHEPGRPP 382 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 357 PGRPPHEPGRP-PHEPGRPPHEPGRPPYEPGRP-PHEPGRPP 396 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP P PP P P P P PP Sbjct: 319 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRP-PHEPGRPP 361 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 350 PGRPPHEPGRP-PHEPGRPPHEPGRPPHEPGRP-PYEPGRPP 389 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P P P PP P PPPP P Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVP 145 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P P P PP P P PP P P Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVP 145 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPPXPPPPPPXXP 453 P P P P PP P PP PPPPP P Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPP-PPPPPAVVP 145 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP 468 P P PP P PPP PP PP Sbjct: 122 PSGPRAPPGGPGAPPPPPPPAVVPP 146 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PP P PP PPPP PP Sbjct: 116 PAPTSVPSGPRAPPGGPGAPP------PPPPPAVVPP 146 >SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG G G G G G Sbjct: 179 GAGGGAVTGVGTPDDGANTDGGGAGGGSVTGVGTPDDGANTDGGG 223 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G G GGG GG G G G G G Sbjct: 159 GGGAVAGVGTADDGANTDGGGAGGGAVTGVGTPDDGANTDGGG 201 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG GGG GGG G G GGG GG Sbjct: 143 GGANTNGGGADNVAATGGGAVAGVGTADDGANTDGGGAGGG 183 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GG G GG G G GGGG G G +GG Sbjct: 622 GGQGGMFGTPGGQQSGFHGGIGGGGMGGGFSGQGG 656 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG G G G GG GGG GGG G GGG Sbjct: 622 GGQGGMFGTPGGQQSGFHGGIGGGG---MGGGFSGQGGG 657 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGG--GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GGGG G G GGG G G Sbjct: 623 GQGGMFGTPGGQQSGFHGGIGGGGMGGGFSGQGGGFPTSQAQADGFG 669 >SB_41815| Best HMM Match : zf-CXXC (HMM E-Value=3.5e-17) Length = 906 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 PP P PPPP P+ P P PP Sbjct: 587 PPKHAPSPPPPPTEVSPKYVIRPGPIDPP 615 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PP P PPPP P P P PP Sbjct: 587 PPKHAPSPPPPPTEVSPKYVIRPGPIDPP 615 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP 468 PP P PPP PP PP P Sbjct: 1009 PPDSPRDPPPITPPPPPVP 1027 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPP 417 L PP P P PP P P PPP P P P P Sbjct: 418 LKPPSSPSPRRQTGPPSPKPSRQPPPSSPQRIAPTPGHRRP 458 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P P PP P PP P PP P P PP P P + P+ Sbjct: 99 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPY 149 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 92 PYEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 141 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 106 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 155 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 113 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 120 PHEPGRPPHEPGRPP--HEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPP 169 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP P P PP P P + P Sbjct: 134 PHEPGRPPHEPGRPP--YEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLP 183 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/77 (27%), Positives = 22/77 (28%), Gaps = 4/77 (5%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPP--PPXXPXPPPPPPXXXPXP--XPPXPX 428 P P P P PP P P PP P PP P P PP Sbjct: 85 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 144 Query: 427 XXPPLXXXXXXNXPFFP 377 PP + P P Sbjct: 145 GRPPYEPGRPPHEPGRP 161 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPP--PXXPPPXPXXXXKXP 387 PP PP P PP P P PP P PP P P Sbjct: 84 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 130 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 102 PGRPPHEPGRP-PHEPGRPPHEPGRPPHEPGRP-PHEPGRPP 141 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 109 PGRPPHEPGRP-PHEPGRPPHEPGRPPHEPGRP-PHEPGRPP 148 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 123 PGRPPHEPGRP-PHEPGRPPHEPGRPPYEPGRP-PHEPGRPP 162 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP P PP P P P P PP Sbjct: 85 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRP-PHEPGRPP 127 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P P PP P PP P P P P PP Sbjct: 116 PGRPPHEPGRP-PHEPGRPPHEPGRPPHEPGRP-PYEPGRPP 155 >SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) Length = 167 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G GGG G GGG GG Sbjct: 105 GVDDGVGGGGGDDSGGDDDGGGVGDDDDDDDDDDDGGGGDHGG 147 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG G G GGG G GG G G G Sbjct: 93 GDDDGGGNNDDDGVDDGVGGGGGDDSGGDDDGGGVG 128 >SB_23371| Best HMM Match : SRCR (HMM E-Value=0) Length = 345 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G GGG G GG GGG G GG GGG Sbjct: 142 GDGGGDDGNGG----DNNGGGDDGNGGDNNGGG 170 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G GG GGG GG G G Sbjct: 144 GGGDDGNGGDNNGGGDDGNGGDNNGGG 170 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G G GGG G GG GG Sbjct: 142 GDGGGDDGNGGDNNGGGDDGNGGDNNGG 169 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G GG GGG G G Sbjct: 135 GYAPGDDGDGGGDDGNGGDNNGGGDDGNGG 164 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG-GGXGGXXGGGGXGXGGG 525 G G G GG G G GG GG G GG GGG Sbjct: 135 GYAPGDDGDGG----GDDGNGGDNNGGGDDGNGGDNNGGG 170 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PPP P P PP PP+ Sbjct: 1122 PLPPPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPPPITINVPPM 1167 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP PPP P P PP PPPP Sbjct: 1122 PLPPPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPPP 1159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.310 0.155 0.525 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,269,093 Number of Sequences: 59808 Number of extensions: 400182 Number of successful extensions: 27994 Number of sequences better than 10.0: 392 Number of HSP's better than 10.0 without gapping: 1252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8968 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -