BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K07 (890 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 65 4e-10 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 63 2e-09 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 63 2e-09 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 61 6e-09 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 61 6e-09 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 61 6e-09 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 60 1e-08 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 60 1e-08 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 60 1e-08 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 60 1e-08 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 60 1e-08 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 60 1e-08 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 60 1e-08 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 60 1e-08 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 60 1e-08 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 60 1e-08 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 60 1e-08 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 59 2e-08 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 58 3e-08 CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. 58 3e-08 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 58 3e-08 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 58 4e-08 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 58 4e-08 AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant pr... 56 1e-07 L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease prot... 56 2e-07 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 56 2e-07 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 56 2e-07 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 56 2e-07 AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. 56 2e-07 AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. 56 2e-07 AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 p... 55 3e-07 AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. 55 3e-07 AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. 55 3e-07 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 55 4e-07 AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. 55 4e-07 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 54 5e-07 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 54 5e-07 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 54 5e-07 BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding prote... 54 7e-07 BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. 54 7e-07 BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding prote... 54 7e-07 AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding prot... 54 7e-07 AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein N... 54 7e-07 U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc ... 54 9e-07 M98776-1|AAB47721.1| 644|Homo sapiens keratin 1 protein. 52 2e-06 DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activ... 52 2e-06 BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. 52 2e-06 BC063697-1|AAH63697.1| 644|Homo sapiens keratin 1 (epidermolyti... 52 2e-06 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 52 2e-06 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 52 2e-06 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 52 2e-06 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 52 2e-06 AF304164-1|AAG41947.1| 644|Homo sapiens keratin 1 protein. 52 2e-06 AF237621-1|AAF60327.1| 644|Homo sapiens keratin 1 protein. 52 2e-06 AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activ... 52 2e-06 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 52 2e-06 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 52 3e-06 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 52 3e-06 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 52 3e-06 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 52 3e-06 X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage f... 52 3e-06 X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. 52 3e-06 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 52 3e-06 BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. 52 3e-06 BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. 52 3e-06 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL445209-3|CAI15184.1| 419|Homo sapiens POU domain, class 4, tr... 52 3e-06 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 52 3e-06 AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenyl... 52 3e-06 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 52 3e-06 U10063-1|AAA57161.1| 423|Homo sapiens POU domain factor protein. 52 4e-06 L20433-1|AAA65605.1| 420|Homo sapiens octamer binding transcrip... 52 4e-06 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 52 4e-06 AK025429-1|BAB15128.1| 274|Homo sapiens protein ( Homo sapiens ... 51 5e-06 AF279145-1|AAK52094.1| 564|Homo sapiens tumor endothelial marke... 51 5e-06 AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activ... 51 5e-06 AC112230-1|AAX88860.1| 329|Homo sapiens unknown protein. 51 5e-06 Z29074-1|CAA82315.1| 623|Homo sapiens cytokeratin 9 protein. 51 6e-06 X75015-1|CAA52924.1| 622|Homo sapiens keratin 9 protein. 51 6e-06 X56597-1|CAA39935.1| 321|Homo sapiens fibrillarin protein. 51 6e-06 S69510-1|AAC60619.1| 622|Homo sapiens cytokeratin 9 protein. 51 6e-06 M59849-1|AAA52453.1| 321|Homo sapiens fibrillarin protein. 51 6e-06 CR457069-1|CAG33350.1| 321|Homo sapiens FBL protein. 51 6e-06 BT020144-1|AAV38946.1| 321|Homo sapiens fibrillarin protein. 51 6e-06 BT006830-1|AAP35476.1| 321|Homo sapiens fibrillarin protein. 51 6e-06 BC121170-1|AAI21171.1| 467|Homo sapiens KRT9 protein protein. 51 6e-06 BC019260-1|AAH19260.1| 321|Homo sapiens fibrillarin protein. 51 6e-06 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 51 6e-06 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 51 6e-06 AC006950-1|AAD15623.1| 227|Homo sapiens FBRL_HUMAN [AA 1- 227] ... 51 6e-06 AC005393-3|AAC28913.1| 318|Homo sapiens FBRL_HUMAN protein. 51 6e-06 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 50 9e-06 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 50 9e-06 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 50 9e-06 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 50 9e-06 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 50 9e-06 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 50 9e-06 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 50 9e-06 X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for ... 50 1e-05 M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-a... 50 1e-05 BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. 50 1e-05 BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit ... 50 1e-05 AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing ... 50 1e-05 AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent prote... 50 1e-05 AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. 50 1e-05 DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. 50 1e-05 DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. 50 1e-05 BC122558-1|AAI22559.1| 578|Homo sapiens keratin 77 protein. 50 1e-05 BC118598-1|AAI18599.1| 345|Homo sapiens KRT1B protein protein. 50 1e-05 BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (D... 50 1e-05 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 50 1e-05 AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. 50 1e-05 AJ564104-1|CAD91892.1| 578|Homo sapiens keratin 1b protein. 50 1e-05 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 50 1e-05 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 50 1e-05 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 50 1e-05 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 49 3e-05 BC030289-1|AAH30289.1| 180|Homo sapiens SIX3 protein protein. 49 3e-05 AL162671-1|CAB83141.1| 164|Homo sapiens human homeobox protein ... 49 3e-05 AJ012611-1|CAB42539.1| 332|Homo sapiens SIX3 protein protein. 49 3e-05 AF092047-1|AAD11939.1| 332|Homo sapiens homeobox protein Six3 p... 49 3e-05 AF083891-1|AAD51091.1| 332|Homo sapiens SIX3 protein protein. 49 3e-05 AF049339-1|AAD15753.1| 332|Homo sapiens Six3 protein. 49 3e-05 AC012354-1|AAX93283.1| 332|Homo sapiens unknown protein. 49 3e-05 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 49 3e-05 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 49 3e-05 X64624-1|CAA45907.1| 331|Homo sapiens RDC-1 protein. 48 3e-05 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 48 3e-05 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 48 3e-05 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 48 3e-05 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 48 3e-05 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 48 3e-05 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 48 3e-05 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 48 3e-05 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 48 3e-05 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 48 3e-05 AL355338-2|CAH70367.1| 532|Homo sapiens Zic family member 2 (od... 48 3e-05 AF193855-1|AAG28409.1| 532|Homo sapiens zinc finger protein of ... 48 3e-05 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 48 3e-05 AF104902-1|AAC96325.1| 533|Homo sapiens ZIC2 protein protein. 48 3e-05 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 48 3e-05 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 48 3e-05 M94077-1|AAA36181.1| 316|Homo sapiens loricrin protein. 48 5e-05 M61120-1|AAA36180.1| 316|Homo sapiens loricrin protein. 48 5e-05 M23263-1|AAA51775.1| 918|Homo sapiens androgen receptor protein. 48 5e-05 L29496-1|AAA51770.1| 734|Homo sapiens AR protein. 48 5e-05 CR536555-1|CAG38792.1| 316|Homo sapiens LOR protein. 48 5e-05 BC108290-1|AAI08291.1| 316|Homo sapiens LOR protein protein. 48 5e-05 BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precu... 48 5e-05 BC034690-1|AAH34690.1| 316|Homo sapiens LOR protein protein. 48 5e-05 AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adapto... 48 5e-05 AL161636-5|CAI19560.1| 312|Homo sapiens loricrin protein. 48 5e-05 AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precu... 48 5e-05 AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. 48 5e-05 AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein pr... 48 5e-05 AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. 48 5e-05 AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. 48 5e-05 AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73... 48 5e-05 AB013076-1|BAA25794.1| 338|Homo sapiens loricrin protein. 48 5e-05 Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. 48 6e-05 X86019-1|CAA60014.1| 494|Homo sapiens SH3-domain interacting pr... 48 6e-05 D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. 48 6e-05 D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternativel... 48 6e-05 BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein pr... 48 6e-05 BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. 48 6e-05 BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. 48 6e-05 BC015180-1|AAH15180.1| 443|Homo sapiens homeobox A3 protein. 48 6e-05 BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. 48 6e-05 BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. 48 6e-05 BC002914-1|AAH02914.1| 358|Homo sapiens WIPF1 protein protein. 48 6e-05 AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protei... 48 6e-05 AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. 48 6e-05 AC004079-3|AAS00376.1| 443|Homo sapiens unknown protein. 48 6e-05 X52426-1|CAA36673.1| 420|Homo sapiens cytokeratin 13 protein. 47 8e-05 J04029-1|AAA60544.1| 561|Homo sapiens keratin 10 protein. 47 8e-05 BC126184-1|AAI26185.1| 458|Homo sapiens keratin 13 protein. 47 8e-05 BC110383-1|AAI10384.1| 594|Homo sapiens FIP1 like 1 (S. cerevis... 47 8e-05 BC077718-1|AAH77718.2| 458|Homo sapiens keratin 13 protein. 47 8e-05 BC052959-1|AAH52959.1| 559|Homo sapiens FIP1L1 protein protein. 47 8e-05 BC043258-1|AAH43258.2| 915|Homo sapiens FBXO11 protein protein. 47 8e-05 BC024016-1|AAH24016.1| 559|Homo sapiens FIP1L1 protein protein. 47 8e-05 BC011543-1|AAH11543.1| 328|Homo sapiens FIP1L1 protein protein. 47 8e-05 BC002661-1|AAH02661.3| 458|Homo sapiens keratin 13 protein. 47 8e-05 AY827075-1|AAV87312.1| 927|Homo sapiens F-box protein 11 protein. 47 8e-05 AY366510-1|AAQ88277.1| 594|Homo sapiens pre-mRNA 3'end processi... 47 8e-05 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 47 8e-05 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 47 8e-05 AF176706-1|AAF17611.1| 192|Homo sapiens F-box protein FBX11 pro... 47 8e-05 AF174599-1|AAF04520.1| 197|Homo sapiens F-box protein Fbx11 pro... 47 8e-05 AF049259-1|AAC35754.1| 420|Homo sapiens keratin 13 protein. 47 8e-05 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 47 8e-05 X14640-1|CAA32786.1| 458|Homo sapiens keratin 13 protein. 47 1e-04 X14487-1|CAA32649.1| 593|Homo sapiens protein ( Human gene for ... 47 1e-04 M77663-1|AAA59199.1| 384|Homo sapiens keratin 10 protein. 47 1e-04 L21990-1|AAA60301.1| 464|Homo sapiens spiceosomal protein protein. 47 1e-04 BC125224-1|AAI25225.1| 748|Homo sapiens LRCH2 protein protein. 47 1e-04 BC044636-1|AAH44636.1| 520|Homo sapiens YLPM1 protein protein. 47 1e-04 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 47 1e-04 BC034697-1|AAH34697.1| 584|Homo sapiens keratin 10 (epidermolyt... 47 1e-04 BC015804-1|AAH15804.1| 481|Homo sapiens SF3A2 protein protein. 47 1e-04 BC009903-1|AAH09903.1| 464|Homo sapiens splicing factor 3a, sub... 47 1e-04 BC004434-1|AAH04434.1| 464|Homo sapiens splicing factor 3a, sub... 47 1e-04 AK091050-1|BAC03574.1| 723|Homo sapiens protein ( Homo sapiens ... 47 1e-04 AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. 47 1e-04 AC005263-1|AAC25613.1| 464|Homo sapiens SP62_HUMAN protein. 47 1e-04 U36561-1|AAA79948.1| 528|Homo sapiens fus-like protein protein. 46 1e-04 M10938-1|AAA36153.1| 493|Homo sapiens protein ( Human epidermal... 46 1e-04 BC150273-1|AAI50274.1| 1422|Homo sapiens YEATS domain containing... 46 1e-04 BC003413-1|AAH03413.1| 217|Homo sapiens nucleolar protein famil... 46 1e-04 AJ276003-1|CAB76563.1| 217|Homo sapiens GAR1 protein protein. 46 1e-04 AB033023-1|BAA86511.1| 1487|Homo sapiens KIAA1197 protein protein. 46 1e-04 U16371-1|AAB60346.1| 31|Homo sapiens androgen receptor protein. 46 2e-04 M99061-1|AAC83410.1| 645|Homo sapiens epidermal cytokeratin 2 p... 46 2e-04 AJ628418-1|CAF31522.1| 600|Homo sapiens keratin 3 protein. 46 2e-04 AF019084-1|AAB81946.1| 645|Homo sapiens keratin 2e protein. 46 2e-04 AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. 46 2e-04 AF305687-1|AAG22558.1| 282|Homo sapiens transcription factor AT... 37 2e-04 AB021663-1|BAA78477.2| 282|Homo sapiens leucine-zipper protein ... 37 2e-04 X05421-1|CAA28996.1| 233|Homo sapiens keratin type II protein. 46 2e-04 M60858-1|AAA59954.1| 707|Homo sapiens nucleolin protein. 46 2e-04 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 46 2e-04 BC111697-1|AAI11698.1| 983|Homo sapiens RBM26 protein protein. 46 2e-04 BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. 46 2e-04 BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. 46 2e-04 BC041655-1|AAH41655.1| 980|Homo sapiens RNA binding motif prote... 46 2e-04 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 46 2e-04 BC006516-1|AAH06516.3| 482|Homo sapiens NCL protein protein. 46 2e-04 BC006494-1|AAH06494.3| 482|Homo sapiens NCL protein protein. 46 2e-04 BC002343-1|AAH02343.3| 482|Homo sapiens NCL protein protein. 46 2e-04 AL646016-1|CAI17009.1| 1865|Homo sapiens formin 2 protein. 46 2e-04 AL590490-1|CAH70931.1| 1865|Homo sapiens formin 2 protein. 46 2e-04 AL513342-1|CAI17121.1| 1865|Homo sapiens formin 2 protein. 46 2e-04 AL359918-1|CAI15795.1| 1865|Homo sapiens formin 2 protein. 46 2e-04 AL159974-2|CAI12923.3| 980|Homo sapiens RNA binding motif prote... 46 2e-04 AL159974-1|CAI12921.2| 1008|Homo sapiens RNA binding motif prote... 46 2e-04 AL139006-2|CAI95137.2| 980|Homo sapiens RNA binding motif prote... 46 2e-04 AL139006-1|CAI95136.1| 1008|Homo sapiens RNA binding motif prote... 46 2e-04 AK223077-1|BAD96797.1| 458|Homo sapiens keratin 13 isoform a va... 46 2e-04 AK223051-1|BAD96771.1| 458|Homo sapiens keratin 13 isoform a va... 46 2e-04 AK127608-1|BAC87055.1| 603|Homo sapiens protein ( Homo sapiens ... 46 2e-04 AK091742-1|BAC03738.1| 687|Homo sapiens protein ( Homo sapiens ... 46 2e-04 AK027456-1|BAB55125.1| 680|Homo sapiens protein ( Homo sapiens ... 46 2e-04 AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens ... 46 2e-04 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 46 2e-04 AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein pr... 46 2e-04 AC017104-2|AAY24247.1| 710|Homo sapiens unknown protein. 46 2e-04 AB209153-1|BAD92390.1| 1332|Homo sapiens formin 2 variant protein. 46 2e-04 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 46 2e-04 X70944-1|CAA50283.1| 707|Homo sapiens PTB-associated splicing f... 45 3e-04 X07881-1|CAA30728.1| 309|Homo sapiens proline-rich protein G1 p... 45 3e-04 BC096212-1|AAH96212.1| 162|Homo sapiens PRB3 protein protein. 45 3e-04 BC096211-1|AAH96211.1| 309|Homo sapiens PRB3 protein protein. 45 3e-04 BC096210-1|AAH96210.1| 309|Homo sapiens PRB3 protein protein. 45 3e-04 BC096209-1|AAH96209.1| 309|Homo sapiens PRB3 protein protein. 45 3e-04 BC051192-1|AAH51192.1| 707|Homo sapiens splicing factor proline... 45 3e-04 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 45 3e-04 BC027708-1|AAH27708.1| 525|Homo sapiens SFPQ protein protein. 45 3e-04 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 45 3e-04 AL590434-2|CAI12467.1| 707|Homo sapiens splicing factor proline... 45 3e-04 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 45 3e-04 AL121749-3|CAC10185.1| 694|Homo sapiens frizzled homolog 8 (Dro... 45 3e-04 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 45 3e-04 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 45 3e-04 AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase k... 45 3e-04 AB043703-1|BAB41064.1| 694|Homo sapiens seven-transmembrane rec... 45 3e-04 M27430-1|AAA51886.1| 919|Homo sapiens AR protein. 45 4e-04 M20132-1|AAA51729.1| 919|Homo sapiens AR protein. 45 4e-04 BC099644-1|AAH99644.1| 639|Homo sapiens keratin 2 (epidermal ic... 45 4e-04 BC099643-1|AAH99643.1| 639|Homo sapiens keratin 2 (epidermal ic... 45 4e-04 BC096294-1|AAH96294.1| 639|Homo sapiens keratin 2 (epidermal ic... 45 4e-04 BC013981-1|AAH13981.1| 932|Homo sapiens RNA binding motif prote... 45 4e-04 BC012787-1|AAH12787.1| 932|Homo sapiens RNA binding motif prote... 45 4e-04 BC008829-1|AAH08829.1| 355|Homo sapiens SHOX2 protein protein. 45 4e-04 AL109827-24|CAI20134.1| 291|Homo sapiens RNA binding motif prot... 45 4e-04 AL109827-23|CAB87611.1| 932|Homo sapiens RNA binding motif prot... 45 4e-04 AJ289772-1|CAC20441.1| 932|Homo sapiens RNA binding motif prote... 45 4e-04 AF393214-1|AAM73682.1| 932|Homo sapiens swan protein. 45 4e-04 AF345335-1|AAL83755.1| 932|Homo sapiens SWAN protein. 45 4e-04 AF345332-1|AAL83752.1| 932|Homo sapiens SWAN protein. 45 4e-04 AF321914-1|AAK09423.1| 544|Homo sapiens androgen receptor protein. 45 4e-04 AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. 45 4e-04 AB018308-1|BAA34485.2| 952|Homo sapiens KIAA0765 protein protein. 45 4e-04 X07696-1|CAA30535.1| 456|Homo sapiens protein ( Human mRNA for ... 44 6e-04 X05418-1|CAA28991.1| 215|Homo sapiens keratin type II (AA1-215)... 44 6e-04 U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated pr... 44 6e-04 M19156-1|AAA59468.1| 433|Homo sapiens KRT10 protein. 44 6e-04 BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein pr... 44 6e-04 BT007261-1|AAP35925.1| 456|Homo sapiens keratin 15 protein. 44 6e-04 BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. 44 6e-04 BC036035-1|AAH36035.1| 979|Homo sapiens DHX36 protein protein. 44 6e-04 BC032652-1|AAH32652.1| 471|Homo sapiens MPN domain containing p... 44 6e-04 BC029566-1|AAH29566.1| 189|Homo sapiens DMRTB1 protein protein. 44 6e-04 BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcri... 44 6e-04 BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. 44 6e-04 BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. 44 6e-04 BC002641-1|AAH02641.1| 456|Homo sapiens keratin 15 protein. 44 6e-04 BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. 44 6e-04 AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated... 44 6e-04 AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid suscepti... 44 6e-04 AL365445-2|CAI22836.1| 342|Homo sapiens DMRT-like family B with... 44 6e-04 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 44 6e-04 AK057273-1|BAB71407.1| 342|Homo sapiens protein ( Homo sapiens ... 44 6e-04 AK027887-1|BAB55432.1| 451|Homo sapiens protein ( Homo sapiens ... 44 6e-04 AJ577134-1|CAE11803.1| 994|Homo sapiens putative DExH/D RNA hel... 44 6e-04 AJ577133-1|CAE11802.1| 1008|Homo sapiens putative DExH/D RNA hel... 44 6e-04 AJ291671-1|CAC40654.1| 336|Homo sapiens doublesex-mab-3 (DM) do... 44 6e-04 AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remod... 44 6e-04 AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. 44 6e-04 AF217190-1|AAG36783.1| 1008|Homo sapiens MLEL1 protein protein. 44 6e-04 AF202320-1|AAF27047.1| 456|Homo sapiens keratin 15 protein. 44 6e-04 AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor ... 44 6e-04 AF091395-1|AAC43042.1| 3038|Homo sapiens Trio isoform protein. 44 6e-04 AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. 44 6e-04 AC007292-2|AAD24593.1| 448|Homo sapiens R31167_2, partial prote... 44 6e-04 AC007292-1|AAD24592.1| 498|Homo sapiens R31167_1, partial prote... 44 6e-04 AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. 44 6e-04 AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. 44 6e-04 AB209754-1|BAD92991.1| 2202|Homo sapiens triple functional domai... 44 6e-04 AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcri... 44 6e-04 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 44 6e-04 AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. 44 6e-04 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 44 7e-04 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 44 7e-04 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 44 7e-04 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 44 7e-04 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 44 7e-04 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 44 7e-04 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 44 7e-04 BC054003-1|AAH54003.1| 1192|Homo sapiens RNASEN protein protein. 44 7e-04 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 44 7e-04 BC008669-1|AAH08669.1| 360|Homo sapiens PRR11 protein protein. 44 7e-04 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 44 7e-04 AY453840-1|AAR24087.1| 538|Homo sapiens atherin protein. 44 7e-04 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 44 7e-04 AK131316-1|BAD18479.1| 568|Homo sapiens protein ( Homo sapiens ... 44 7e-04 AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens ... 44 7e-04 AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens ... 44 7e-04 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 44 7e-04 AK001891-1|BAA91964.1| 360|Homo sapiens protein ( Homo sapiens ... 44 7e-04 AK000296-1|BAA91064.1| 210|Homo sapiens protein ( Homo sapiens ... 44 7e-04 AJ400879-3|CAC35389.1| 1214|Homo sapiens KIAA0298 protein protein. 44 7e-04 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 44 7e-04 AF189011-1|AAF80558.1| 1374|Homo sapiens ribonuclease III protein. 44 7e-04 AB002296-1|BAA20758.2| 901|Homo sapiens KIAA0298 protein protein. 44 7e-04 Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 pro... 44 0.001 X58964-1|CAA41730.1| 979|Homo sapiens MHC class II regulatory ... 44 0.001 U80743-1|AAB91441.1| 556|Homo sapiens CAGH32 protein. 44 0.001 S79867-1|AAB35421.1| 473|Homo sapiens type I keratin 16 protein. 44 0.001 M96684-1|AAA60229.1| 322|Homo sapiens Pur protein. 44 0.001 M28439-1|AAA59460.1| 470|Homo sapiens keratin type 16 protein. 44 0.001 J00124-1|AAB59562.1| 472|Homo sapiens keratin protein. 44 0.001 BT019388-1|AAV38195.1| 322|Homo sapiens purine-rich element bin... 44 0.001 BC113470-1|AAI13471.1| 378|Homo sapiens LOC653115 protein protein. 44 0.001 BC112027-1|AAI12028.1| 378|Homo sapiens heterogeneous nuclear r... 44 0.001 BC111727-1|AAI11728.1| 1077|Homo sapiens transcription elongatio... 44 0.001 BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. 44 0.001 BC049826-1|AAH49826.1| 979|Homo sapiens regulatory factor X, 1 ... 44 0.001 BC042437-1|AAH42437.1| 472|Homo sapiens keratin 14 (epidermolys... 44 0.001 BC039169-1|AAH39169.1| 473|Homo sapiens keratin 16 (focal non-e... 44 0.001 BC036087-1|AAH36087.1| 322|Homo sapiens purine-rich element bin... 44 0.001 BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IM... 44 0.001 AY363225-1|AAQ63629.1| 378|Homo sapiens heterogeneous nuclear r... 44 0.001 AY044869-1|AAK97789.1| 3124|Homo sapiens p400 SWI2/SNF2-related ... 44 0.001 AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 p... 44 0.001 AL161779-2|CAI42091.1| 1478|Homo sapiens IQ motif and Sec7 domai... 44 0.001 AL139396-1|CAI39832.1| 1478|Homo sapiens IQ motif and Sec7 domai... 44 0.001 AK128195-1|BAC87319.1| 976|Homo sapiens BP4). protein. 44 0.001 AK096970-1|BAC04915.1| 485|Homo sapiens protein ( Homo sapiens ... 44 0.001 AK024089-1|BAB14822.1| 593|Homo sapiens protein ( Homo sapiens ... 44 0.001 AF061812-1|AAC99326.1| 473|Homo sapiens keratin 16 protein. 44 0.001 AF061809-1|AAD15829.1| 473|Homo sapiens keratin 16 protein. 44 0.001 AF017789-1|AAB80727.1| 1098|Homo sapiens putative transcription ... 44 0.001 AC079305-1|AAY14709.1| 378|Homo sapiens unknown protein. 44 0.001 AB209910-1|BAD93147.1| 1081|Homo sapiens transcription elongatio... 44 0.001 AB095934-1|BAC23110.2| 1032|Homo sapiens KIAA2014 protein protein. 44 0.001 AB058721-1|BAB47447.1| 1157|Homo sapiens KIAA1818 protein protein. 44 0.001 AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. 44 0.001 AB011094-1|BAA25448.1| 1560|Homo sapiens KIAA0522 protein protein. 44 0.001 Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated ph... 43 0.001 X98893-1|CAA67398.1| 589|Homo sapiens hTAFII68 protein. 43 0.001 X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated ph... 43 0.001 X71428-1|CAA50559.1| 525|Homo sapiens FUS gycline rich protein ... 43 0.001 U51334-1|AAC50932.1| 592|Homo sapiens putative RNA binding prot... 43 0.001 S62140-1|AAB27102.1| 526|Homo sapiens TLS protein. 43 0.001 CR456747-1|CAG33028.1| 526|Homo sapiens FUS protein. 43 0.001 BT007131-1|AAP35795.1| 526|Homo sapiens fusion, derived from t(... 43 0.001 BC046099-1|AAH46099.2| 592|Homo sapiens TAF15 RNA polymerase II... 43 0.001 BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated ... 43 0.001 BC026062-1|AAH26062.1| 526|Homo sapiens fusion (involved in t(1... 43 0.001 BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated ... 43 0.001 BC002459-1|AAH02459.1| 526|Homo sapiens fusion (involved in t(1... 43 0.001 BC000402-1|AAH00402.1| 526|Homo sapiens fusion (involved in t(1... 43 0.001 AY780787-1|AAV98357.1| 199|Homo sapiens nucleolar protein famil... 43 0.001 AY197697-1|AAO13485.1| 589|Homo sapiens TAF15 RNA polymerase II... 43 0.001 AK025837-1|BAB15254.1| 616|Homo sapiens protein ( Homo sapiens ... 43 0.001 AJ549096-1|CAD79346.1| 157|Homo sapiens BBF2H7/FUS protein prot... 43 0.001 AF071213-2|AAC35284.1| 525|Homo sapiens FUS/TLS protein protein. 43 0.001 AF071213-1|AAC35285.1| 526|Homo sapiens FUS/TLS protein protein. 43 0.001 AB208902-1|BAD92139.1| 300|Homo sapiens fusion (involved in t(1... 43 0.001 AB010067-2|BAA33812.1| 589|Homo sapiens RBP56/hTAFII68 protein. 43 0.001 AB010067-1|BAA33811.1| 592|Homo sapiens RBP56/hTAFII68 protein. 43 0.001 M35851-1|AAA51772.1| 917|Homo sapiens androgen receptor protein. 43 0.002 M21748-1|AAA51771.1| 917|Homo sapiens androgen receptor protein. 43 0.002 L20969-1|AAC00042.1| 809|Homo sapiens cyclic AMP phosphodiester... 43 0.002 EF695441-1|ABS01479.1| 231|Homo sapiens extraembryonic spermato... 43 0.002 EF695423-1|ABS01461.1| 231|Homo sapiens extraembryonic spermato... 43 0.002 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 43 0.002 BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein pr... 43 0.002 BX537888-1|CAD97884.1| 500|Homo sapiens hypothetical protein pr... 43 0.002 BT007186-1|AAP35850.1| 472|Homo sapiens keratin 14 (epidermolys... 43 0.002 BC109221-1|AAI09222.1| 1019|Homo sapiens SLC4A5 protein protein. 43 0.002 BC094830-1|AAH94830.1| 472|Homo sapiens keratin 14 (epidermolys... 43 0.002 BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (D... 43 0.002 BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting pr... 43 0.002 BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. 43 0.002 BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (D... 43 0.002 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 43 0.002 BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (D... 43 0.002 BC019097-1|AAH19097.1| 472|Homo sapiens keratin 14 (epidermolys... 43 0.002 BC018135-1|AAH18135.1| 471|Homo sapiens pre-mRNA cleavage facto... 43 0.002 BC002690-1|AAH02690.1| 472|Homo sapiens keratin 14 (epidermolys... 43 0.002 AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form... 43 0.002 AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr... 43 0.002 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 43 0.002 AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL356358-1|CAI40496.1| 920|Homo sapiens androgen receptor (dihy... 43 0.002 AL354995-2|CAI14980.1| 760|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL354995-1|CAI14979.1| 708|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D... 43 0.002 AL163542-2|CAH73005.1| 760|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL163542-1|CAH73006.1| 708|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL158016-1|CAI40853.1| 920|Homo sapiens androgen receptor (dihy... 43 0.002 AL139186-2|CAC12840.2| 760|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL139186-1|CAI16673.1| 708|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL138698-3|CAH73304.1| 760|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL138698-2|CAH73303.1| 708|Homo sapiens dachshund homolog 1 (Dr... 43 0.002 AL137724-1|CAB70894.1| 439|Homo sapiens hypothetical protein pr... 43 0.002 AL049564-2|CAI43080.1| 920|Homo sapiens androgen receptor (dihy... 43 0.002 AK092024-1|BAC03793.1| 699|Homo sapiens protein ( Homo sapiens ... 43 0.002 AK027184-1|BAB15686.1| 412|Homo sapiens protein ( Homo sapiens ... 43 0.002 AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. 43 0.002 AJ275970-1|CAC81661.1| 471|Homo sapiens pre-mRNA cleavage facto... 43 0.002 AF453528-1|AAL50802.1| 760|Homo sapiens sodium bicarbonate cotr... 43 0.002 AF452248-1|AAL48291.1| 1051|Homo sapiens sodium bicarbonate cotr... 43 0.002 AF356492-1|AAL08487.1| 706|Homo sapiens dachshund protein. 43 0.002 AF321917-1|AAK09426.1| 531|Homo sapiens androgen receptor protein. 43 0.002 AF321916-1|AAK09425.1| 542|Homo sapiens androgen receptor protein. 43 0.002 AF321915-1|AAK09424.1| 539|Homo sapiens androgen receptor protein. 43 0.002 AF293338-1|AAK97073.1| 1040|Homo sapiens sodium bicarbonate cotr... 43 0.002 AF293337-1|AAK97072.1| 1121|Homo sapiens sodium bicarbonate cotr... 43 0.002 AF243499-1|AAK26741.1| 1137|Homo sapiens sodium bicarbonate cotr... 43 0.002 AF207661-1|AAG18492.1| 1074|Homo sapiens sodium bicarbonate cotr... 43 0.002 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 43 0.002 AF102546-1|AAF01351.1| 706|Homo sapiens dachshund protein. 43 0.002 AC078834-1|AAS01989.1| 439|Homo sapiens unknown protein. 43 0.002 AC073263-6|AAX93062.1| 714|Homo sapiens unknown protein. 43 0.002 AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho... 43 0.002 AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho... 43 0.002 AB209752-1|BAD92989.1| 906|Homo sapiens sodium bicarbonate tran... 43 0.002 AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. 43 0.002 X63522-1|CAA45087.1| 533|Homo sapiens retinoic acid X receptor ... 42 0.002 M84820-1|AAA60293.1| 533|Homo sapiens retinoid X receptor beta ... 42 0.002 L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain p... 42 0.002 EF695444-1|ABS01482.1| 231|Homo sapiens extraembryonic spermato... 42 0.002 EF695443-1|ABS01481.1| 231|Homo sapiens extraembryonic spermato... 42 0.002 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 64.9 bits (151), Expect = 4e-10 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPP P PPPPPP P PP P PPP P Sbjct: 327 PLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAP 371 Score = 57.2 bits (132), Expect = 7e-08 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPP----PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPL PP P P PPPP P P PP P P PPP PPP P Sbjct: 334 PPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPP 382 Score = 54.4 bits (125), Expect = 5e-07 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP P PPPPPP P P PP P PPP Sbjct: 327 PLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPP 369 Score = 54.0 bits (124), Expect = 7e-07 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP+ PP PP P PP PPPPP P PPPP PPP P Sbjct: 315 PAPPM-PPVSAGPPLP--PPPPPPPPLPPPSSAGPPPPPPPPPLP 356 Score = 53.6 bits (123), Expect = 9e-07 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPP P P PP P P PP P PP Sbjct: 320 PPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPP 379 Score = 50.0 bits (114), Expect = 1e-05 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXF 368 P PP P PPP P PPPPPP P PP P PP P P F Sbjct: 326 PPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLF 385 Query: 367 FXL 359 F L Sbjct: 386 FGL 388 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P P P PP P PP P P P PPPP P P P Sbjct: 331 PPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPP 382 Score = 45.6 bits (103), Expect = 2e-04 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPX------PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 L PPP PPPP P PP PP PPPP PPP P P Sbjct: 293 LPPPPASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGP 346 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PP PP PP P P P P P PPP Sbjct: 315 PAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPP 374 Query: 414 XXXXXXXTPLFF 379 LFF Sbjct: 375 GLAPPPPPGLFF 386 Score = 40.3 bits (90), Expect = 0.009 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPP-PPXXPXPP--PPPPXXXPXPXPPXPXXXPPLXXXXXX 395 P P P P P PP PP PP PPPP P P P PP Sbjct: 297 PASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLP 356 Query: 394 NXPFFP 377 N P P Sbjct: 357 NSPAPP 362 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 62.9 bits (146), Expect = 2e-09 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP----XXPXXXXPPPPXXPPP 414 P PP PPP P PPPP PP PPPPPP PPPP PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 48.4 bits (110), Expect = 3e-05 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PPPP P PPPPPP P P PP P Sbjct: 912 PHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 48.0 bits (109), Expect = 5e-05 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP----XPPXPXXXPP 416 P P PP P PPPP P PPPPPP PP P PP Sbjct: 912 PHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP PPP P P PPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPP 964 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPPPPP PPPP PPP P P Sbjct: 919 PPPPPP-------PPPPPPPPPPPPPPPPPP 942 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 62.9 bits (146), Expect = 2e-09 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP----XXPXXXXPPPPXXPPP 414 P PP PPP P PPPP PP PPPPPP PPPP PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 48.4 bits (110), Expect = 3e-05 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PPPP P PPPPPP P P PP P Sbjct: 912 PHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 48.0 bits (109), Expect = 5e-05 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP----XPPXPXXXPP 416 P P PP P PPPP P PPPPPP PP P PP Sbjct: 912 PHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP PPP P P PPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPP 964 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPPPPP PPPP PPP P P Sbjct: 919 PPPPPP-------PPPPPPPPPPPPPPPPPP 942 >X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. Length = 421 Score = 60.9 bits (141), Expect = 6e-09 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PL P PP PPPP PP PPPPPP P PPPP PPP P K P Sbjct: 331 PPRPLPPRPPAAQPPPPPSPP-PPPPPPASPL---PPPPPPPPPTPSSTTKLP 379 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PPPP PP PPPPPP P P PP P P Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPP-PPPPPPASPLPPPPPPPPPTP 372 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-PPPPPXXPRXPXPPXPXXPPP 415 P PP PP PP P PPPPP P P PP P PPP Sbjct: 325 PWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 46.4 bits (105), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPPP P PPPPP P P PP P Sbjct: 325 PWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPP 369 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP P PPPPPP P P P P Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPP---PPPTPSSTTKLP 379 Score = 43.2 bits (97), Expect = 0.001 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPP---PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PP P P P P P PP P PPPP PPP P P Sbjct: 310 PPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLP 362 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PP P PPPP P P PP PP Sbjct: 304 PPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPP 363 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 14/53 (26%) Frame = -1 Query: 524 PPPXPXPPPPXXPP-------------XPPPPP-PXXPXXXXPPPPXXPPPXP 408 PPP PPP PP PPP P P P PPPP PPP P Sbjct: 302 PPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPP 354 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P P PP P PP P PPP P P Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPPTPSSTTKLP 379 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPR 451 P P PP PPPP PP P P+ Sbjct: 348 PSPPPPPPPPASPLPPPPPPPPPTPSSTTKLPQ 380 >X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. Length = 421 Score = 60.9 bits (141), Expect = 6e-09 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PL P PP PPPP PP PPPPPP P PPPP PPP P K P Sbjct: 331 PPRPLPPRPPAAQPPPPPSPP-PPPPPPASPL---PPPPPPPPPTPSSTTKLP 379 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PPPP PP PPPPPP P P PP P P Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPP-PPPPPPASPLPPPPPPPPPTP 372 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-PPPPPXXPRXPXPPXPXXPPP 415 P PP PP PP P PPPPP P P PP P PPP Sbjct: 325 PWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 46.4 bits (105), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPPP P PPPPP P P PP P Sbjct: 325 PWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPP 369 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP P PPPPPP P P P P Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPP---PPPTPSSTTKLP 379 Score = 43.2 bits (97), Expect = 0.001 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPP---PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PP P P P P P PP P PPPP PPP P P Sbjct: 310 PPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLP 362 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PP P PPPP P P PP PP Sbjct: 304 PPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPP 363 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 14/53 (26%) Frame = -1 Query: 524 PPPXPXPPPPXXPP-------------XPPPPP-PXXPXXXXPPPPXXPPPXP 408 PPP PPP PP PPP P P P PPPP PPP P Sbjct: 302 PPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPP 354 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P P PP P PP P PPP P P Sbjct: 330 PPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPPTPSSTTKLP 379 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPR 451 P P PP PPPP PP P P+ Sbjct: 348 PSPPPPPPPPASPLPPPPPPPPPTPSSTTKLPQ 380 >M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. Length = 184 Score = 60.9 bits (141), Expect = 6e-09 Identities = 29/53 (54%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PL P PP PPPP PP PPPPPP P PPPP PPP P K P Sbjct: 94 PPRPLPPRPPAAQPPPPPSPP-PPPPPPASPL---PPPPPPPPPTPSSTTKLP 142 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PPPP PP PPPPPP P P PP P P Sbjct: 93 PPPRPLPPRPPAAQPPPPPSPP-PPPPPPASPLPPPPPPPPPTP 135 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-PPPPPXXPRXPXPPXPXXPPP 415 P PP PP PP P PPPPP P P PP P PPP Sbjct: 88 PWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPP 133 Score = 46.4 bits (105), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPPP P PPPPP P P PP P Sbjct: 88 PWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPP 132 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP P PPPPPP P P P P Sbjct: 93 PPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPP---PPPTPSSTTKLP 142 Score = 43.2 bits (97), Expect = 0.001 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPP---PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PP P P P P P PP P PPPP PPP P P Sbjct: 73 PPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLP 125 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PP P PPPP P P PP PP Sbjct: 67 PPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPP 126 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 14/53 (26%) Frame = -1 Query: 524 PPPXPXPPPPXXPP-------------XPPPPP-PXXPXXXXPPPPXXPPPXP 408 PPP PPP PP PPP P P P PPPP PPP P Sbjct: 65 PPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPP 117 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P P PP P PP P PPP P P Sbjct: 93 PPPRPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPPTPSSTTKLP 142 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPR 451 P P PP PPPP PP P P+ Sbjct: 111 PSPPPPPPPPASPLPPPPPPPPPTPSSTTKLPQ 143 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 330 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P P P P PPPPPP P PP P PPL Sbjct: 317 PPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 372 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 318 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 367 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 339 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 287 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 327 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 267 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 321 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 288 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 330 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 267 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 311 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 291 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 330 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P P P P PPPPPP P PP P PPL Sbjct: 274 PPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 329 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 275 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 324 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 267 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 296 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 60.1 bits (139), Expect = 1e-08 Identities = 27/55 (49%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXX-PXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P PPPP PP P P PPP P PPPP PPP P P Sbjct: 95 PTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPP 149 Score = 55.2 bits (127), Expect = 3e-07 Identities = 27/60 (45%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-----PXXPPPXPXXXXKXP 387 P PPL PPP P P P P PPPPPP P PPP P PPP P P Sbjct: 84 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPP 143 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P L PP P P PP PP PPP P PPPP P P Sbjct: 114 PQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAP 158 Score = 48.8 bits (111), Expect = 3e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP PPPP P PPPPPP PP P P Sbjct: 127 PTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSP 171 Score = 48.4 bits (110), Expect = 3e-05 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P P P P PPPPP P P PP P P Sbjct: 99 PAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAP 158 Query: 415 L 413 L Sbjct: 159 L 159 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPP-XXPRXPXPPXPXXPPP 415 P P PP PPPP PP P P PPP P PP P PPP Sbjct: 93 PPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPP 140 Score = 46.4 bits (105), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PPPP P P PPP P P P P PP Sbjct: 95 PTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPP 139 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP P P PPP P P PP PP Sbjct: 97 PPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPP 150 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXPXP 327 P PP PPP PP P PPP PPP P P + P P P Sbjct: 84 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPP 143 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP P P PPPPP P P P P PPP Sbjct: 107 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPP-PPPPAMPSPPPP 151 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP P PPPPP P P P P P Sbjct: 127 PTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSP 171 Score = 42.3 bits (95), Expect = 0.002 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXP--PXPPPP-------PPXXPXXXXPPPPXXPPPXPXXXXK 393 PP PPP P PPPP P P PPPP PP P P P P P K Sbjct: 132 PP--PPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRPLHLAK 186 Score = 40.3 bits (90), Expect = 0.009 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P P PPP P P PPPP P P P P PPL + P Sbjct: 84 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSP---PPLVAPTPSSPP 133 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXP---PPPXXPXPPPPPPXXXPXPXPPXPXX 425 P P P P P PP P P P P P PPPP P P P P Sbjct: 93 PPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSP-PPPPLPPPPPPAMPSPPPP 151 Query: 424 XPP 416 PP Sbjct: 152 PPP 154 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PPP P PP P P P P P Sbjct: 140 PPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRP 181 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP PP PPP P P PP P P Sbjct: 71 PLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPP 114 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 543 PXXPPXXXXXXX-PPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PPPP PPPPPP P P PP P P Sbjct: 119 PSPPPLVAPTPSSPPPPPL---PPPPPPAMPSPPPPPPPAAAP 158 Score = 38.7 bits (86), Expect = 0.028 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP---PXXXPXPXPPXPXXXPP 416 P P P PP P PP P PPPPP P P P P P Sbjct: 122 PPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDP 174 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPP P PP P P P P Sbjct: 123 PLVAPTPSSPPPPPLPPPP-PPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRP 181 Query: 415 L 413 L Sbjct: 182 L 182 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P P P PP PPPP P PP P P P P P Sbjct: 121 PPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPP-PAAAPLAAPPEEPAAPSPEDPELP 177 Score = 31.9 bits (69), Expect = 3.2 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPX-PXPPP----PXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPL P P PPP P P PP P PP P P P P Sbjct: 58 PPLAPAAAVPGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPP 112 Score = 31.1 bits (67), Expect = 5.6 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 15/67 (22%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP----------PXPP----PPPPXXPRXPXP-PXPXXPPPXX 409 P PP P PP P P PP PPP P P P P P PPP Sbjct: 55 PDGPPLAPAAAVPGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPP 114 Query: 408 XXXXXTP 388 +P Sbjct: 115 QPALPSP 121 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP P P P PP PPP P P P P Sbjct: 69 PPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPP 114 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 330 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P P P P PPPPPP P PP P PPL Sbjct: 317 PPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 372 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 318 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 367 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 339 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 330 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P P P P PPPPPP P PP P PPL Sbjct: 317 PPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 372 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 318 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 367 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 339 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 577 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 617 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 557 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 611 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 557 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 601 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 581 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP--XPXPPXPXXXPPL 413 P P PP P PP P PPPPPP P P PP P PPL Sbjct: 578 PPPPGPP------PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 619 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 565 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 614 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 557 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 586 Score = 31.1 bits (67), Expect = 5.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXP 453 P PPP P PPPPP P Sbjct: 459 PVSPPPTSGPAAPPPPPPLP 478 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 330 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P P P P PPPPPP P PP P PPL Sbjct: 317 PPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 372 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 318 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 367 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 339 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 577 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 617 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 557 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 611 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 557 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 601 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 581 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP--XPXPPXPXXXPPL 413 P P PP P PP P PPPPPP P P PP P PPL Sbjct: 578 PPPPGPP------PPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 619 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 565 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 614 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 557 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 586 Score = 31.1 bits (67), Expect = 5.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXP 453 P PPP P PPPPP P Sbjct: 459 PVSPPPTSGPAAPPPPPPLP 478 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 227 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 267 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 207 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 261 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 228 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 270 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 207 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 251 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 231 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 270 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P P P P PPPPPP P PP P PPL Sbjct: 214 PPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 269 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 215 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 264 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 207 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 236 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 60.1 bits (139), Expect = 1e-08 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 L PPP P PPPP PPPPPP P PPP PPP P Sbjct: 330 LPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAP 370 Score = 51.2 bits (117), Expect = 5e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX-----PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PP P PP P PPPP PPPP PPP P P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P PP PPPP P PPPP P P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 45.2 bits (102), Expect = 3e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPP P P P PP P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P P PP P P PP P Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P P P P PPPPPP P PP P PPL Sbjct: 317 PPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPL 372 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P PPPPP P P P PPP Sbjct: 318 PLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 367 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 498 PXXPPXPPPPPPXXPRXPX--PPXPXXPPP 415 P PP PPP PP + PP P PPP Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPP 339 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 60.1 bits (139), Expect = 1e-08 Identities = 27/55 (49%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXX-PXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P PPPP PP P P PPP P PPPP PPP P P Sbjct: 640 PTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPP 694 Score = 55.2 bits (127), Expect = 3e-07 Identities = 27/60 (45%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-----PXXPPPXPXXXXKXP 387 P PPL PPP P P P P PPPPPP P PPP P PPP P P Sbjct: 629 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPP 688 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P L PP P P PP PP PPP P PPPP P P Sbjct: 659 PQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAP 703 Score = 48.8 bits (111), Expect = 3e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP PPPP P PPPPPP PP P P Sbjct: 672 PTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSP 716 Score = 48.4 bits (110), Expect = 3e-05 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P P P P PPPPP P P PP P P Sbjct: 644 PAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAP 703 Query: 415 L 413 L Sbjct: 704 L 704 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPP-XXPRXPXPPXPXXPPP 415 P P PP PPPP PP P P PPP P PP P PPP Sbjct: 638 PPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPP 685 Score = 46.4 bits (105), Expect = 1e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PPPP P P PPP P P P P PP Sbjct: 640 PTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPP 684 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP P P PPP P P PP PP Sbjct: 642 PPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPP 695 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXPXP 327 P PP PPP PP P PPP PPP P P + P P P Sbjct: 629 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPP 688 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP P P PPPPP P P P P PPP Sbjct: 652 PPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPP-PPPPAMPSPPPP 696 Score = 43.6 bits (98), Expect = 0.001 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP P PPPPP P P P P P Sbjct: 672 PTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSP 716 Score = 42.3 bits (95), Expect = 0.002 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXP--PXPPPP-------PPXXPXXXXPPPPXXPPPXPXXXXK 393 PP PPP P PPPP P P PPPP PP P P P P P K Sbjct: 677 PP--PPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRPLHLAK 731 Score = 40.3 bits (90), Expect = 0.009 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P P PPP P P PPPP P P P P PPL + P Sbjct: 629 PEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSP---PPLVAPTPSSPP 678 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXP---PPPXXPXPPPPPPXXXPXPXPPXPXX 425 P P P P P PP P P P P P PPPP P P P P Sbjct: 638 PPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSP-PPPPLPPPPPPAMPSPPPP 696 Query: 424 XPP 416 PP Sbjct: 697 PPP 699 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PPP P PP P P P P P Sbjct: 685 PPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRP 726 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP PP PPP P P PP P P Sbjct: 616 PLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPP 659 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 543 PXXPPXXXXXXX-PPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PPPP PPPPPP P P PP P P Sbjct: 664 PSPPPLVAPTPSSPPPPPL---PPPPPPAMPSPPPPPPPAAAP 703 Score = 38.7 bits (86), Expect = 0.028 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP---PXXXPXPXPPXPXXXPP 416 P P P PP P PP P PPPPP P P P P P Sbjct: 667 PPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDP 719 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPP P PP P P P P Sbjct: 668 PLVAPTPSSPPPPPLPPPP-PPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRP 726 Query: 415 L 413 L Sbjct: 727 L 727 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P P P PP PPPP P PP P P P P P Sbjct: 666 PPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPP-PAAAPLAAPPEEPAAPSPEDPELP 722 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPP 465 P P PP P PP PPPPP Sbjct: 7 PGVPPGPPHPVRPPPPPPPP 26 Score = 31.9 bits (69), Expect = 3.2 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -1 Query: 536 PPLXPPPX-PXPPP----PXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPL P P PPP P P PP P PP P P P P Sbjct: 603 PPLAPAAAVPGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPP 657 Score = 31.1 bits (67), Expect = 5.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P PPP PP PPP P P P Sbjct: 215 PHQAAPPPPPPPPPPPAPASEPKGGLTSP 243 Score = 31.1 bits (67), Expect = 5.6 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 15/67 (22%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP----------PXPP----PPPPXXPRXPXP-PXPXXPPPXX 409 P PP P PP P P PP PPP P P P P P PPP Sbjct: 600 PDGPPLAPAAAVPGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPP 659 Query: 408 XXXXXTP 388 +P Sbjct: 660 QPALPSP 666 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP P P P PP PPP P P P P Sbjct: 614 PPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPP 659 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 59.3 bits (137), Expect = 2e-08 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P L PPP P PPPP P PPPPPP PP P PPP Sbjct: 64 PFAALPPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPP 106 Score = 56.4 bits (130), Expect = 1e-07 Identities = 23/52 (44%), Positives = 24/52 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P PP P PP PPP P PP PPP P + P Sbjct: 77 PPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPPRKDQQP 128 Score = 55.6 bits (128), Expect = 2e-07 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP P PPPP P PPPPPP PPP PPP P Sbjct: 69 PPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPP 106 Score = 53.6 bits (123), Expect = 9e-07 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PPPP PP PPPPP P PP PPP P Sbjct: 64 PFAALPPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPP 105 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 596 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 638 Score = 46.8 bits (106), Expect = 1e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPPP P PPPPPP PP P PPL Sbjct: 75 PPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPL 107 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX-----PPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP PPPPPP R P P PP Sbjct: 73 PPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPP 122 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 9/55 (16%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXX---------PXXXXPPPPXXPPPXPXXXXKXP 387 PPP P P P PPPPPP P PPPP PPP P P Sbjct: 32 PPPAPGPGAGLLAPGPPPPPPVGSMGALTAAFPFAALPPPPPPPPPPPPQQPPPP 86 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 PPPP PP PPPPP P P PP P P PL+ Sbjct: 69 PPPP--PPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLY 108 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 596 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 636 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 598 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 648 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 8/52 (15%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPX--------PPPPPPXXXPXPXPPXPXXXP 419 P P PP P PPPP P PPPPP P P P P Sbjct: 71 PPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPP 122 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P P P PPPPPP P PP P PP Sbjct: 32 PPPAPGPGAGLLAPGPPPPPPVGSMGALTAAFPFAALPPPPPPPPPPPPQQPPPPPPPP 90 Score = 35.5 bits (78), Expect = 0.26 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXP-PPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PP P P PPP P P P P PP P Sbjct: 69 PPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPPRKDQQP 128 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 542 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 581 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 604 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 649 Score = 32.7 bits (71), Expect = 1.8 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFX 363 P L PP P P P P PPP P P PPP P + F Sbjct: 9 PLGKLGPPGLPPLPGPKGGFEPGPPPAPGPGAGLLAP--GPPPPPPVGSMGALTAAFPFA 66 Query: 362 XXPXXXXXXPXP 327 P P P Sbjct: 67 ALPPPPPPPPPP 78 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 542 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 572 Score = 30.7 bits (66), Expect = 7.4 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 15/58 (25%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP------PXPPPPPP---------XXPRXPXPPXPXXPPP 415 P P PPP P P PPPPPP P PP P PPP Sbjct: 20 PLPGPKGGFEPGPPPAPGPGAGLLAPGPPPPPPVGSMGALTAAFPFAALPPPPPPPPP 77 Score = 30.7 bits (66), Expect = 7.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 596 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 625 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 597 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 635 >Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for acrosin (EC 3.4.21.10). ). Length = 421 Score = 58.4 bits (135), Expect = 3e-08 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP P P PP PPPPPP P PPPP PPP P K P Sbjct: 331 PPRPLPPRPPAAQPRPPPSPPPPPPP-PASPLPPPPPPPPPTPSSTTKLP 379 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP PP PPPPPP P P PP P P Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPP-PPPPPPASPLPPPPPPPPPTP 372 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPP P PPPPP P P PP P Sbjct: 325 PWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPP 369 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PPPP P PPPPPP P P P P Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPP---PPPTPSSTTKLP 379 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXPXXPPP 415 P PP PP P P PP PP P P PP P PPP Sbjct: 325 PWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPP---PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PP P P P P P PP P PPP PPP P P Sbjct: 310 PPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLP 362 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP PPP PP P P PPP PP P + P Sbjct: 302 PPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPP 347 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PP P P PP P P PP PP Sbjct: 304 PPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPP 363 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P PP P PP P PPP P P Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPPPTPSSTTKLP 379 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPR 451 P P PP PPPP PP P P+ Sbjct: 348 PSPPPPPPPPASPLPPPPPPPPPTPSSTTKLPQ 380 >CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. Length = 421 Score = 58.4 bits (135), Expect = 3e-08 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP P P PP PPPPPP P PPPP PPP P K P Sbjct: 331 PPRPLPPRPPAAQPRPPPSPPPPPPP-PASPLPPPPPPPPPTPSSTTKLP 379 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP PP PPPPPP P P PP P P Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPP-PPPPPPASPLPPPPPPPPPTP 372 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPP P PPPPP P P PP P Sbjct: 325 PWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPP 369 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PPPP P PPPPPP P P P P Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPP---PPPTPSSTTKLP 379 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXPXXPPP 415 P PP PP P P PP PP P P PP P PPP Sbjct: 325 PWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPP---PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PP P P P P P PP P PPP PPP P P Sbjct: 310 PPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLP 362 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP PPP PP P P PPP PP P + P Sbjct: 302 PPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPP 347 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PP P P PP P P PP PP Sbjct: 304 PPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPP 363 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P PP P PP P PPP P P Sbjct: 330 PPPRPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPPPPPPPTPSSTTKLP 379 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPR 451 P P PP PPPP PP P P+ Sbjct: 348 PSPPPPPPPPASPLPPPPPPPPPTPSSTTKLPQ 380 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 58.4 bits (135), Expect = 3e-08 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP P P PP PPPPPP P PPPP PPP P K P Sbjct: 142 PPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLPPPPPP-PPPTPSSTTKLP 190 Score = 50.4 bits (115), Expect = 9e-06 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP PPP P PPP PP PPPPPP Sbjct: 155 PRPPPSPPPPPPPPPSPLPPPPPPPPP 181 Score = 47.2 bits (107), Expect = 8e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PP PPPPPP P PP P PPP Sbjct: 141 PPPRPLPPRPPAAQPRPPPSPPPPPPPPP----SPLPPPPPPPPP 181 Score = 46.0 bits (104), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PPP P PPPPPP P P PP P Sbjct: 136 PWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLPPPPPPPP 180 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P P PP P P PP P P PP P PP Sbjct: 115 PPTTRPPPIRPPFSHPLSAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLPP 174 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PP P PPP P PPP P P P PP P Sbjct: 130 PLSAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPP-PPPSPLPPPPPPPPPTP 183 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPP---PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP+ PP P P P P P PP P PPP PPP P P Sbjct: 121 PPIRPPFSHPLSAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLP 173 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP PPP PP P P PPP PP P + P Sbjct: 113 PPPPTTRPPPIRPPFSHPLSAHLPWYFQPPPRPLPPRPPAAQPRPP 158 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP-PXXXPXPXPPXP 431 P P P P P PPPP P PPPPP P P P Sbjct: 141 PPPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLPPPPPPPPPTPSSTTKLP 190 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P PP P P PP P PPP P P Sbjct: 141 PPPRPLPPRPPAAQPRPPPSPPPPPPPPPSPLPPPPPPPPPTPSSTTKLP 190 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPR 451 P P PP PPPP PP P P+ Sbjct: 159 PSPPPPPPPPPSPLPPPPPPPPPTPSSTTKLPQ 191 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 58.0 bits (134), Expect = 4e-08 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = -1 Query: 533 PLXPPPXPXPPP----------PXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL PPP P PP P PP PPPPPP P PPPP PPP P Sbjct: 441 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 492 Score = 57.6 bits (133), Expect = 6e-08 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP---XXXXPPPPXXPP 417 P P PPP P PPPP PP PPPPPP P P PP PP Sbjct: 463 PVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPP 507 Score = 57.6 bits (133), Expect = 6e-08 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP PP PPPPP P P P PP P Sbjct: 467 PMPP--PPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLP 509 Score = 51.6 bits (118), Expect = 4e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP PP P P P PP PP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 515 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPPPPP P P PP P PPP Sbjct: 446 PPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPP 490 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PP PPPPPP P P PP P P P PL Sbjct: 466 PPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPL 504 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP-----PXPXXXPPL 413 P PP P PPPP P PPPPPP P P P P P PPL Sbjct: 463 PVTPPMPP---PPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPL 508 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPPPP P P PP P P Sbjct: 441 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGP 494 Score = 45.6 bits (103), Expect = 2e-04 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P P P P P PPPPPP P P PP P PPL P Sbjct: 441 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVP 500 Query: 385 FFP 377 P Sbjct: 501 APP 503 Score = 44.4 bits (100), Expect = 6e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PPPP PP PPPP P P P PP Sbjct: 466 PPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPP 507 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXPP 418 P P PP PPPP PP P P P P PP P PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPP 513 Score = 41.1 bits (92), Expect = 0.005 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPP-PPPXXPRXPXPP-XPXXP--PPXXXXXXXTPLF 382 P PP PPPP PP PPP P P P PP P P PP T +F Sbjct: 467 PMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGTSSPTVVF 524 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPP----PPPPXXXPXP-XPPXPXXXPP 416 P P P PP P PPPP P P P PP P P PP P P Sbjct: 466 PPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGTSSP 520 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPP P PP P P P PP P Sbjct: 463 PVTPPMPPPPPPPPPP------PPPPPPPPPPPPLPGPAAETVPAPPLAPPLP 509 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P P P PP P PP P P Sbjct: 478 PPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGTSSP 520 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 9/49 (18%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-------PXPP--PPPPXXPRXPXPPXP 430 P P PP PPPP P P PP PP P P P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGTSSP 520 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 58.0 bits (134), Expect = 4e-08 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = -1 Query: 533 PLXPPPXPXPPP----------PXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL PPP P PP P PP PPPPPP P PPPP PPP P Sbjct: 544 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 595 Score = 57.6 bits (133), Expect = 6e-08 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP---XXXXPPPPXXPP 417 P P PPP P PPPP PP PPPPPP P P PP PP Sbjct: 566 PVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPP 610 Score = 57.6 bits (133), Expect = 6e-08 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP PP PPPPP P P P PP P Sbjct: 570 PMPP--PPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLP 612 Score = 51.6 bits (118), Expect = 4e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PPPP PP P P P PP PP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPPLP 618 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPPPPP P P PP P PPP Sbjct: 549 PPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPP 593 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PP PPPPPP P P PP P P P PL Sbjct: 569 PPMPPPPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPL 607 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP-----PXPXXXPPL 413 P PP P PPPP P PPPPPP P P P P P PPL Sbjct: 566 PVTPPMPP---PPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPL 611 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP P PPPPPP P P PP P P Sbjct: 544 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGP 597 Score = 45.6 bits (103), Expect = 2e-04 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P P P P P PPPPPP P P PP P PPL P Sbjct: 544 PLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPASETVP 603 Query: 385 FFP 377 P Sbjct: 604 APP 606 Score = 44.4 bits (100), Expect = 6e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PPPP PP PPPP P P P PP Sbjct: 569 PPMPPPPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPP 610 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXPP 418 P P PP PPPP PP P P P P PP P PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPP 616 Score = 41.1 bits (92), Expect = 0.005 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPP-PPPXXPRXPXPP-XPXXP--PPXXXXXXXTPLF 382 P PP PPPP PP PPP P P P PP P P PP T +F Sbjct: 570 PMPPPPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPPLPGTSSPTVVF 627 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPP----PPPPXXXPXP-XPPXPXXXPP 416 P P P PP P PPPP P P P PP P P PP P P Sbjct: 569 PPMPPPPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPPLPGTSSP 623 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPP P PP P P P PP P Sbjct: 566 PVTPPMPPPPPPPPPP------PPPPPPPPPPPPLPGPASETVPAPPLAPPLP 612 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P P P P PP P PP P P Sbjct: 581 PPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPPLPGTSSP 623 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 9/49 (18%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-------PXPP--PPPPXXPRXPXPPXP 430 P P PP PPPP P P PP PP P P P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPPLPGTSSP 623 >AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant protein. Length = 410 Score = 56.4 bits (130), Expect = 1e-07 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPP 417 P PP+ PPP PPP PP P PPPPP PPPP PP Sbjct: 313 PPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPP 356 Score = 48.4 bits (110), Expect = 3e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPP--PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP P P PP P PP PPPP P PP P PPP P P Sbjct: 297 PPAHLPYHPHVYPPNPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFP 348 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXP 408 P PPP P PPPP P PP PP P PPP P PPP P Sbjct: 309 PPNPPPPPVPPPPASFP-PPAIPPPTPGYPPPPPTYNPNFPPPPP 352 Score = 48.0 bits (109), Expect = 5e-05 Identities = 21/53 (39%), Positives = 23/53 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 PP PP P P P PPPPP P PPP PPP P P ++ Sbjct: 292 PPAYGPPAHLPYHPHVYPPNPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYN 344 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 536 PPLXPPPXP--XPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPP P PPPP P PPPPP P PP PPP Sbjct: 326 PPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPP--HPPP 366 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P P PP PPP P PPPPP P PP P PP Sbjct: 310 PNPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHP--PP 366 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP----XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP PP P PP PPP P P PP PPP Sbjct: 349 PPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPPPIPPP 395 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PP P PPP PPPPP P PP Sbjct: 305 PHVYPPNPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPP 351 Score = 41.1 bits (92), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PPPP PP PP P PP PP P Sbjct: 338 PPPPTYNPNFP-PPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVP 381 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PPPP P PPPP P PP P PP Sbjct: 292 PPAYGPPAHLPYHPHVYPPNPPPP--PVPPPPASFPPPAIPPPTPGYPPP 339 Score = 39.1 bits (87), Expect = 0.021 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP--PPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPP PP PPP P PP P PP Sbjct: 341 PTYNPNFPPPPPRLPPTHAV--PPHPPPGLGLPPASYPPPAVPPGGQPPVPPPIPP 394 Score = 37.9 bits (84), Expect = 0.049 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P P L PP PPP P PP PP P PP Sbjct: 364 PPPGLGLPPASYPPPAVPPGGQPPVPPPIPPPGMPP 399 Score = 37.5 bits (83), Expect = 0.065 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 6/65 (9%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXP--PPPXXPXP----PPPPPXXXPXPXPPX 434 P P P P PP P PPP P P PPPPP P PP Sbjct: 292 PPAYGPPAHLPYHPHVYPPNPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPP 351 Query: 433 PXXXP 419 P P Sbjct: 352 PRLPP 356 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX-PPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP PP PPP P P P PPP Sbjct: 350 PPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPPPIPPP 395 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPX---PPPPPPXXPRXPXP-PXPXXPP 418 P PP PPPP PP PP PPP P P P PP Sbjct: 337 PPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPP 382 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPP PP PP PP P PPP PP Sbjct: 361 PPHPPPGLGLPPASYPPPAVPPGGQPPVPPPIPPPGMPP 399 Score = 34.7 bits (76), Expect = 0.46 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 16/61 (26%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-----PPXXPPXP-----------PPPPPXXPXXXXPPPPXXPPPX 411 P PP PPP PP PP P PPP P PP P PPP Sbjct: 194 PLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRPPPP 253 Query: 410 P 408 P Sbjct: 254 P 254 Score = 33.9 bits (74), Expect = 0.80 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 PP P P PPP P PPPPPP Sbjct: 233 PPAHPAPVHQPPP--LPHRPPPPPP 255 Score = 33.1 bits (72), Expect = 1.4 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPP---PXXPXPPPPPPXXX--PXPXPPX- 434 P P P P PP P PPP P PP PPP P PP Sbjct: 320 PPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPA 379 Query: 433 --PXXXPPL 413 P PP+ Sbjct: 380 VPPGGQPPV 388 Score = 31.5 bits (68), Expect = 4.2 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 13/73 (17%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPP-------XXPPXPPP----PPPXXPRX 448 P P P PP PPPP PP PPP PP P Sbjct: 319 PPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPP 378 Query: 447 PXPP--XPXXPPP 415 PP P PPP Sbjct: 379 AVPPGGQPPVPPP 391 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP PP PP PP P P P P PP Sbjct: 356 PTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPPPIPPPGMPP 399 >L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease protein protein. Length = 3144 Score = 56.0 bits (129), Expect = 2e-07 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P PPPP P PP P P PPPP PPP P Sbjct: 42 PPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGP 80 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PP P PPP P P P PP P PPPP P Sbjct: 44 PPPPPPPPQLPQPPPQAQPLLPQPQPPPPP----PPPPPGP 80 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPP P P P P P P PP P Sbjct: 41 PPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGP 80 Score = 41.9 bits (94), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP--PXPXXPPPXXXXXXXTPL 385 PPPP P P PPP P P P P P PPP PL Sbjct: 45 PPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPL 87 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP--PXPPPPPPXXPRXPXPPXPXXP 421 P P PP PPP P P P PPPP P P P P Sbjct: 42 PPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEP 86 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P PP P P PP P PPPP P P Sbjct: 43 PPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEP 86 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPP---PXXPPPXPXXXXKXP 387 PP PPPPPP P PPP P P P P P Sbjct: 41 PPPPPPPPP-PPQLPQPPPQAQPLLPQPQPPPPPPPP 76 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 56.0 bits (129), Expect = 2e-07 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PP P P PPPPPP P P PP PPP P Sbjct: 148 PPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPP 192 Score = 55.6 bits (128), Expect = 2e-07 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PP PP PPPPPP PPPP PPP P Sbjct: 148 PPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPP 194 Score = 52.8 bits (121), Expect = 2e-06 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PPPP PP PPPP P PPPP PP P Sbjct: 154 PEPPPAPPLPGDLPPPP--PPPPPPPGTDGPVPPPPPPPPPPPGGP 197 Score = 49.2 bits (112), Expect = 2e-05 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -1 Query: 542 PXPPLX----PPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPP 417 P PPL PPP P PPPP P PPPPPP PPPP PP Sbjct: 158 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPP------PPPPPGGPP 198 Score = 48.8 bits (111), Expect = 3e-05 Identities = 27/59 (45%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLX--PPPXPXPP--PPXXPPXP--PPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P PPL P P PP PP PP P P PPP P PPPP PPP P P Sbjct: 126 PPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 184 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P PPPP PPPPP P P PP P PP Sbjct: 145 PQAPPLPGSPEPPPAPPLPGDLPPPPPP----PPPPPGTDGPVPPPPPPPPPPP 194 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 16/59 (27%) Frame = -1 Query: 542 PXPPLXPPPXP----------XPP--PPXXPPXP----PPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP PP P PPP P P PPPP PPP Sbjct: 118 PAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 176 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PP PPPPPP P PP P PPP Sbjct: 134 PSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTD-GPVPPPPPPPPP 192 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXPXPPXPXX 424 P P P P P PP PP P PPPPP P P P Sbjct: 125 PPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 184 Query: 423 PPP 415 PPP Sbjct: 185 PPP 187 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 11/53 (20%) Frame = -1 Query: 533 PLXPPPXPX-PPPPXXPPXPPP----------PPPXXPXXXXPPPPXXPPPXP 408 P PPP P P P PP PP PPP P PPP PPP P Sbjct: 124 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 176 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXP 408 PP PP P P PP PP P P PPPP PPP P Sbjct: 140 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPP 188 Score = 39.9 bits (89), Expect = 0.012 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXX---PXPPPPPPXXXPXPXPP 437 P P P P PPPP P PPPPPP P PP Sbjct: 158 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 198 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP-PPXXXPXPXPPXPXXXP 419 P P P P PP P PP P PP P P P PP P P Sbjct: 108 PSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLP 167 Query: 418 P 416 P Sbjct: 168 P 168 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP---PPXXPXXXXP-PPPXXPPPXPXXXXKXP 387 P P P PPPP P P P PP P P P PPP P P Sbjct: 114 PAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLP 167 Score = 35.5 bits (78), Expect = 0.26 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP--PXXPPPXPXXXXKXP 387 P P L P P P P PPPP P P PP P PP P P Sbjct: 108 PSPDLAPAAEPAP---GAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPP 158 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPP-PXXP----XPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPP P P PP PP P P P P PPL Sbjct: 114 PAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPL 162 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 8/41 (19%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPX--------PPPPPPXXPRXP 445 P PP PPPP PP PPPPPP P P Sbjct: 157 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 197 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP P P PP PPPPP P PP P P+ Sbjct: 145 PQAPPLPGSPEPPPAPPLPGDLPPPPP-----PPPPPPGTDGPV 183 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P P P PP PPP PP PPP P Sbjct: 154 PEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 197 Score = 32.3 bits (70), Expect = 2.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P P P P PPPP P PP PP Sbjct: 157 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPP--PPPPGGPP 198 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PPPPP P P P PP P P Sbjct: 104 PTGSPSPDLAPAAEPAPGAAPPPPP--PLPGLPSPQEAPPSAPPQAPPLP 151 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 4/64 (6%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXP--XPPXPX 427 P P P P P PP PP P P P P P PP P Sbjct: 93 PSGGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPG 152 Query: 426 XPPP 415 P P Sbjct: 153 SPEP 156 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXP--PPPXXPPPXP 408 P P P P P PPPPP P P PP PP P Sbjct: 101 PGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAP 148 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 56.0 bits (129), Expect = 2e-07 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PP P P PPPPPP P P PP PPP P Sbjct: 566 PPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPP 610 Score = 55.6 bits (128), Expect = 2e-07 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PP PP PPPPPP PPPP PPP P Sbjct: 566 PPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPP 612 Score = 52.8 bits (121), Expect = 2e-06 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PPPP PP PPPP P PPPP PP P Sbjct: 572 PEPPPAPPLPGDLPPPP--PPPPPPPGTDGPVPPPPPPPPPPPGGP 615 Score = 49.2 bits (112), Expect = 2e-05 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -1 Query: 542 PXPPLX----PPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPP 417 P PPL PPP P PPPP P PPPPPP PPPP PP Sbjct: 576 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPP------PPPPPGGPP 616 Score = 48.8 bits (111), Expect = 3e-05 Identities = 27/59 (45%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLX--PPPXPXPP--PPXXPPXP--PPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P PPL P P PP PP PP P P PPP P PPPP PPP P P Sbjct: 544 PPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 602 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P PPPP PPPPP P P PP P PP Sbjct: 563 PQAPPLPGSPEPPPAPPLPGDLPPPPPP----PPPPPGTDGPVPPPPPPPPPPP 612 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 16/59 (27%) Frame = -1 Query: 542 PXPPLXPPPXP----------XPP--PPXXPPXP----PPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP PP P PPP P P PPPP PPP Sbjct: 536 PAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 594 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PP PPPPPP P PP P PPP Sbjct: 552 PSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTD-GPVPPPPPPPPP 610 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXPXPPXPXX 424 P P P P P PP PP P PPPPP P P P Sbjct: 543 PPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 602 Query: 423 PPP 415 PPP Sbjct: 603 PPP 605 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 11/53 (20%) Frame = -1 Query: 533 PLXPPPXPX-PPPPXXPPXPPP----------PPPXXPXXXXPPPPXXPPPXP 408 P PPP P P P PP PP PPP P PPP PPP P Sbjct: 542 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 594 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXP 408 PP PP P P PP PP P P PPPP PPP P Sbjct: 558 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPP 606 Score = 39.9 bits (89), Expect = 0.012 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXX---PXPPPPPPXXXPXPXPP 437 P P P P PPPP P PPPPPP P PP Sbjct: 576 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP-PPXXXPXPXPPXPXXXP 419 P P P P PP P PP P PP P P P PP P P Sbjct: 526 PSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLP 585 Query: 418 P 416 P Sbjct: 586 P 586 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP---PPXXPXXXXP-PPPXXPPPXPXXXXKXP 387 P P P PPPP P P P PP P P P PPP P P Sbjct: 532 PAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLP 585 Score = 35.5 bits (78), Expect = 0.26 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP--PXXPPPXPXXXXKXP 387 P P L P P P P PPPP P P PP P PP P P Sbjct: 526 PSPDLAPAAEPAP---GAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPP 576 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPP-PXXP----XPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPP P P PP PP P P P P PPL Sbjct: 532 PAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPL 580 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 8/41 (19%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPX--------PPPPPPXXPRXP 445 P PP PPPP PP PPPPPP P P Sbjct: 575 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP P P PP PPPPP P PP P P+ Sbjct: 563 PQAPPLPGSPEPPPAPPLPGDLPPPPP-----PPPPPPGTDGPV 601 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P P P PP PPP PP PPP P Sbjct: 572 PEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 Score = 32.3 bits (70), Expect = 2.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P P P P PPPP P PP PP Sbjct: 575 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPP--PPPPGGPP 616 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PPPPP P P P PP P P Sbjct: 522 PTGSPSPDLAPAAEPAPGAAPPPPP--PLPGLPSPQEAPPSAPPQAPPLP 569 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 4/64 (6%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXP--XPPXPX 427 P P P P P PP PP P P P P P PP P Sbjct: 511 PSGGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPG 570 Query: 426 XPPP 415 P P Sbjct: 571 SPEP 574 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXP--PPPXXPPPXP 408 P P P P P PPPPP P P PP PP P Sbjct: 519 PGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAP 566 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 56.0 bits (129), Expect = 2e-07 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PP P P PPPPPP P P PP PPP P Sbjct: 457 PPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPP 501 Score = 55.6 bits (128), Expect = 2e-07 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PP PP PPPPPP PPPP PPP P Sbjct: 457 PPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPP 503 Score = 52.8 bits (121), Expect = 2e-06 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PPPP PP PPPP P PPPP PP P Sbjct: 463 PEPPPAPPLPGDLPPPP--PPPPPPPGTDGPVPPPPPPPPPPPGGP 506 Score = 49.2 bits (112), Expect = 2e-05 Identities = 25/47 (53%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -1 Query: 542 PXPPLX----PPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPP 417 P PPL PPP P PPPP P PPPPPP PPPP PP Sbjct: 467 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPP------PPPPPGGPP 507 Score = 48.8 bits (111), Expect = 3e-05 Identities = 27/59 (45%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLX--PPPXPXPP--PPXXPPXP--PPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P PPL P P PP PP PP P P PPP P PPPP PPP P P Sbjct: 435 PPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 493 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P PPPP PPPPP P P PP P PP Sbjct: 454 PQAPPLPGSPEPPPAPPLPGDLPPPPPP----PPPPPGTDGPVPPPPPPPPPPP 503 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 16/59 (27%) Frame = -1 Query: 542 PXPPLXPPPXP----------XPP--PPXXPPXP----PPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP PP P PPP P P PPPP PPP Sbjct: 427 PAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 485 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PP PPPPPP P PP P PPP Sbjct: 443 PSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTD-GPVPPPPPPPPP 501 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXPXPPXPXX 424 P P P P P PP PP P PPPPP P P P Sbjct: 434 PPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 493 Query: 423 PPP 415 PPP Sbjct: 494 PPP 496 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 11/53 (20%) Frame = -1 Query: 533 PLXPPPXPX-PPPPXXPPXPPP----------PPPXXPXXXXPPPPXXPPPXP 408 P PPP P P P PP PP PPP P PPP PPP P Sbjct: 433 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 485 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXP 408 PP PP P P PP PP P P PPPP PPP P Sbjct: 449 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPP 497 Score = 39.9 bits (89), Expect = 0.012 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXX---PXPPPPPPXXXPXPXPP 437 P P P P PPPP P PPPPPP P PP Sbjct: 467 PAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 507 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP-PPXXXPXPXPPXPXXXP 419 P P P P PP P PP P PP P P P PP P P Sbjct: 417 PSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLP 476 Query: 418 P 416 P Sbjct: 477 P 477 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP---PPXXPXXXXP-PPPXXPPPXPXXXXKXP 387 P P P PPPP P P P PP P P P PPP P P Sbjct: 423 PAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLP 476 Score = 35.5 bits (78), Expect = 0.26 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP--PXXPPPXPXXXXKXP 387 P P L P P P P PPPP P P PP P PP P P Sbjct: 417 PSPDLAPAAEPAP---GAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPP 467 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPP-PXXP----XPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPP P P PP PP P P P P PPL Sbjct: 423 PAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPL 471 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 8/41 (19%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPX--------PPPPPPXXPRXP 445 P PP PPPP PP PPPPPP P P Sbjct: 466 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 506 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PP P P PP PPPPP P PP P P+ Sbjct: 454 PQAPPLPGSPEPPPAPPLPGDLPPPPP-----PPPPPPGTDGPV 492 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P P P PP PPP PP PPP P Sbjct: 463 PEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 506 Score = 32.3 bits (70), Expect = 2.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P P P P PPPP P PP PP Sbjct: 466 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPP--PPPPGGPP 507 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P P PPPPP P P P PP P P Sbjct: 413 PTGSPSPDLAPAAEPAPGAAPPPPP--PLPGLPSPQEAPPSAPPQAPPLP 460 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 4/64 (6%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXP--XPPXPX 427 P P P P P PP PP P P P P P PP P Sbjct: 402 PSGGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPG 461 Query: 426 XPPP 415 P P Sbjct: 462 SPEP 465 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXP--PPPXXPPPXP 408 P P P P P PPPPP P P PP PP P Sbjct: 410 PGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAP 457 >AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. Length = 1134 Score = 56.0 bits (129), Expect = 2e-07 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP-----XPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P PPPP PP PP PPP P PPPP PP P Sbjct: 956 PPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLP 1005 Score = 55.2 bits (127), Expect = 3e-07 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-PPXXPPXPPPP-PPXXPXXXXPPPPXXPPP 414 P PPL PPP P PP P PP PPPP P P P PP PPP Sbjct: 963 PHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPPP 1007 Score = 50.0 bits (114), Expect = 1e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P L PP P P P PPPPPP P PPPP PPP P P Sbjct: 936 PGAGLPPPRAPALPSEARAPPPPPPPPPHPPL--PPPPLPPPPLPLRLPPLP 985 Score = 50.0 bits (114), Expect = 1e-05 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP-PPPXXPPPXPXXXXKXP 387 P PPP P PPP P PP PPP P P PPP P P P P Sbjct: 949 PSEARAPPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLP 1001 Score = 50.0 bits (114), Expect = 1e-05 Identities = 25/57 (43%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Frame = -1 Query: 542 PXPPLXPPPXPX-----PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPL PPP P PPPP P PPPPPP P PPP P + P Sbjct: 968 PPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPP--LLPPPQTRTLPAARTMRQPP 1022 Score = 48.0 bits (109), Expect = 5e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXX--PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP P P PPPP P P P PP P PP Sbjct: 955 PPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPP 1006 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXP-----PPPPPXXXPXPXPPXPXXXPPL 413 P PP P PPPP P P PP PP P P PP P PPL Sbjct: 955 PPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPL 1003 Score = 46.0 bits (104), Expect = 2e-04 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP--PPP-----PXXPXXXXPPPPXXPPP 414 PPL PPP P P PP PP PP PPP P PPPP P Sbjct: 982 PPLPPPPLPRPHPPPPPPLPPLLPPPQTRTLPAARTMRQPPPPRLALP 1029 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPPP P PP PP P P PP P PPL Sbjct: 936 PGAGLPPPRAPALPSEARAPPPPPPPPPHPPLPP--PPLPPPPLPLRLPPL 984 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPPP PP PP PP P P PP P PP Sbjct: 941 PPPRAPALPSEARAPPPPPPPPPHPPLPP--PPLPPPPLPLRLPP 983 Score = 43.6 bits (98), Expect = 0.001 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPX-----PPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PP PP PPP PR P PP P PP Sbjct: 956 PPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPR-PHPPPPPPLPP 1002 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P P P P PPPP P PPPPPP P P P P Sbjct: 956 PPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPPPQTRTLP 1013 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPP-PXXPPXPPPPPPXXPRXPXPPX--PXXPPP 415 P P PP PPP P P PPPP P P PP P PPP Sbjct: 960 PPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPPP 1007 Score = 40.7 bits (91), Expect = 0.007 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P P PPPP P PPPP P P P PPL P P Sbjct: 946 PALPSEARAPPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLP 1001 Score = 37.1 bits (82), Expect = 0.085 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPP-----PXXPRXPXP-PXPXXPPP 415 P P PP P PP PP PPPP P P P P P P PPP Sbjct: 955 PPPPPPPP------PHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPP 999 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPL PPP P PPPP PP PP P P Sbjct: 999 PLPPLLPPPQTRTLPAARTMRQPPPPRLALPRRRRSPP-RPPSRPARRGPRP 1049 Score = 30.7 bits (66), Expect = 7.4 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 5/63 (7%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPP-----PPPXXPRXPXPPXP 430 P P P P PP PPPP P PPP P R P PP Sbjct: 968 PPPPLPPPPLPLRLPPLPP-PPLPRPHPPPPPPLPPLLPPPQTRTLPAARTMRQPPPPRL 1026 Query: 429 XXP 421 P Sbjct: 1027 ALP 1029 >AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. Length = 3144 Score = 56.0 bits (129), Expect = 2e-07 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P PPPP P PP P P PPPP PPP P Sbjct: 42 PPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGP 80 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PP P PPP P P P PP P PPPP P Sbjct: 44 PPPPPPPPQLPQPPPQAQPLLPQPQPPPPP----PPPPPGP 80 Score = 41.9 bits (94), Expect = 0.003 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPP P P P P P P PP P Sbjct: 41 PPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGP 80 Score = 41.9 bits (94), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP--PXPXXPPPXXXXXXXTPL 385 PPPP P P PPP P P P P P PPP PL Sbjct: 45 PPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPL 87 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP--PXPPPPPPXXPRXPXPPXPXXP 421 P P PP PPP P P P PPPP P P P P Sbjct: 42 PPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEP 86 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P PP P P PP P PPPP P P Sbjct: 43 PPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEP 86 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPP---PXXPPPXPXXXXKXP 387 PP PPPPPP P PPP P P P P P Sbjct: 41 PPPPPPPPP-PPQLPQPPPQAQPLLPQPQPPPPPPPP 76 >AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 protein. Length = 2715 Score = 55.2 bits (127), Expect = 3e-07 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPPP PP P PPPP P PPPP PPP P Sbjct: 402 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPP 434 Score = 51.6 bits (118), Expect = 4e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPP----PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPL PP P P PPP PP P PPP P PPP PPP P Sbjct: 402 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPP--PPPVSPPPLPSPPPPP 448 Score = 50.0 bits (114), Expect = 1e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPPPXP 408 L PPP P P PP PPP PPP P PPPP PPP P Sbjct: 401 LPPPPLTPPAPSPPPPLPPPSTSPPP--PLCPPPPPPVSPPPLP 442 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXP 420 P PPL PPP PPP PP P PPPPP PPP P Sbjct: 424 PPPPLCPPP---PPPVSPPPLPSPPPPPAQEEQEESPPPVVP 462 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPP P P PP P Sbjct: 404 PPLTPPAPSPPPPLPPPSTSPPPPLCP-PPPPPVSPPPLPSPPPP 447 Score = 45.6 bits (103), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PP PP P PP P PP Sbjct: 403 PPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPP 447 Score = 41.9 bits (94), Expect = 0.003 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPP P PPP P P P PP Sbjct: 405 PLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPP 458 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 507 PPPPXXPPX---PPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 PPPP PP PPP PP P P P PPP +P Sbjct: 402 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSP 444 Score = 37.5 bits (83), Expect = 0.065 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 2/72 (2%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP--XPPPPPPXXPRXPXPPXPXXP 421 P P P P P PPPP PP PPPPP P P P Sbjct: 403 PPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPPVVP 462 Query: 420 PPXXXXXXXTPL 385 PL Sbjct: 463 ATCSRKRGRPPL 474 Score = 35.1 bits (77), Expect = 0.34 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP 468 PPP P PPPP P PP P Sbjct: 619 PPPPPAPPPPPAPSPPPAP 637 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPP-LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP + P PP PP P P P P PP P P P Sbjct: 552 PKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTPVPLP 597 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPPPP P PPP PPP P + P Sbjct: 619 PPPPPAPP----PPPAPSPPPAPATSSRRP 644 Score = 32.3 bits (70), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXP 454 PPPP PP P P PP P Sbjct: 620 PPPPAPPPPPAPSPPPAP 637 Score = 32.3 bits (70), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXP 453 PPPP PP P P PP P Sbjct: 620 PPPPAPPPPPAPSPPPAP 637 Score = 31.5 bits (68), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPP 465 L PPP PPPP P PPP P Sbjct: 618 LPPPPPAPPPPP--APSPPPAP 637 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 PP PPP P PPP PP P P P Sbjct: 619 PP--PPPAPPPPPAPSPPPAPATSSRRPLLLRAP 650 Score = 31.1 bits (67), Expect = 5.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP 486 P PP PPP P P PP P Sbjct: 619 PPPPPAPPPPPAPSPPPAP 637 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 502 PPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 PPP P PPPPP P P P P L Sbjct: 619 PPP--PPAPPPPPAPSPPPAPATSSRRPLL 646 Score = 27.1 bits (57), Expect(2) = 4.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 477 PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PPPPP P PP PPP PL Sbjct: 619 PPPPPAPP----PPPAPSPPPAPATSSRRPL 645 Score = 22.6 bits (46), Expect(2) = 4.9 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P PP P P P PP P P Sbjct: 566 PITTSPPVPQEPAPVPSPPRAPTPPSTPVPLP 597 >AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. Length = 2605 Score = 55.2 bits (127), Expect = 3e-07 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPPP PP P PPPP P PPPP PPP P Sbjct: 292 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPP 324 Score = 51.6 bits (118), Expect = 4e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPP----PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPL PP P P PPP PP P PPP P PPP PPP P Sbjct: 292 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPP--PPPVSPPPLPSPPPPP 338 Score = 50.0 bits (114), Expect = 1e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPPPXP 408 L PPP P P PP PPP PPP P PPPP PPP P Sbjct: 291 LPPPPLTPPAPSPPPPLPPPSTSPPP--PLCPPPPPPVSPPPLP 332 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXP 420 P PPL PPP PPP PP P PPPPP PPP P Sbjct: 314 PPPPLCPPP---PPPVSPPPLPSPPPPPAQEEQEESPPPVVP 352 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPP P P PP P Sbjct: 294 PPLTPPAPSPPPPLPPPSTSPPPPLCP-PPPPPVSPPPLPSPPPP 337 Score = 45.6 bits (103), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PP PP P PP P PP Sbjct: 293 PPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPP 337 Score = 41.9 bits (94), Expect = 0.003 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPP P PPP P P P PP Sbjct: 295 PLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPP 348 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 507 PPPPXXPPX---PPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 PPPP PP PPP PP P P P PPP +P Sbjct: 292 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSP 334 Score = 37.5 bits (83), Expect = 0.065 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 2/72 (2%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP--XPPPPPPXXPRXPXPPXPXXP 421 P P P P P PPPP PP PPPPP P P P Sbjct: 293 PPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPPVVP 352 Query: 420 PPXXXXXXXTPL 385 PL Sbjct: 353 ATCSRKRGRPPL 364 Score = 35.1 bits (77), Expect = 0.34 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP 468 PPP P PPPP P PP P Sbjct: 509 PPPPPAPPPPPAPSPPPAP 527 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPP-LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP + P PP PP P P P P PP P P P Sbjct: 442 PKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTPVPLP 487 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPPPP P PPP PPP P + P Sbjct: 509 PPPPPAPP----PPPAPSPPPAPATSSRRP 534 Score = 32.3 bits (70), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXP 454 PPPP PP P P PP P Sbjct: 510 PPPPAPPPPPAPSPPPAP 527 Score = 32.3 bits (70), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXP 453 PPPP PP P P PP P Sbjct: 510 PPPPAPPPPPAPSPPPAP 527 Score = 31.5 bits (68), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPP 465 L PPP PPPP P PPP P Sbjct: 508 LPPPPPAPPPPP--APSPPPAP 527 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 PP PPP P PPP PP P P P Sbjct: 509 PP--PPPAPPPPPAPSPPPAPATSSRRPLLLRAP 540 Score = 31.1 bits (67), Expect(2) = 0.075 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP 486 P PP PPP P P PP P Sbjct: 509 PPPPPAPPPPPAPSPPPAP 527 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 502 PPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 PPP P PPPPP P P P P L Sbjct: 509 PPP--PPAPPPPPAPSPPPAPATSSRRPLL 536 Score = 25.0 bits (52), Expect(2) = 0.075 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPP P P P PP P P Sbjct: 558 PPPLGAPEAPEPEPPPADDSPAEPEP 583 >AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. Length = 2415 Score = 55.2 bits (127), Expect = 3e-07 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPPP PP P PPPP P PPPP PPP P Sbjct: 102 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPP 134 Score = 51.6 bits (118), Expect = 4e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPP----PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPL PP P P PPP PP P PPP P PPP PPP P Sbjct: 102 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPP--PPPVSPPPLPSPPPPP 148 Score = 50.0 bits (114), Expect = 1e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPPPXP 408 L PPP P P PP PPP PPP P PPPP PPP P Sbjct: 101 LPPPPLTPPAPSPPPPLPPPSTSPPP--PLCPPPPPPVSPPPLP 142 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXP 420 P PPL PPP PPP PP P PPPPP PPP P Sbjct: 124 PPPPLCPPP---PPPVSPPPLPSPPPPPAQEEQEESPPPVVP 162 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPP P P PP P Sbjct: 104 PPLTPPAPSPPPPLPPPSTSPPPPLCP-PPPPPVSPPPLPSPPPP 147 Score = 45.6 bits (103), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PP PP P PP P PP Sbjct: 103 PPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPP 147 Score = 41.9 bits (94), Expect = 0.003 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PPP P PPP P P P PP Sbjct: 105 PLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPP 158 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 507 PPPPXXPPX---PPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 PPPP PP PPP PP P P P PPP +P Sbjct: 102 PPPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSP 144 Score = 37.5 bits (83), Expect = 0.065 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 2/72 (2%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP--XPPPPPPXXPRXPXPPXPXXP 421 P P P P P PPPP PP PPPPP P P P Sbjct: 103 PPPLTPPAPSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPPVVP 162 Query: 420 PPXXXXXXXTPL 385 PL Sbjct: 163 ATCSRKRGRPPL 174 Score = 35.1 bits (77), Expect = 0.34 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP 468 PPP P PPPP P PP P Sbjct: 319 PPPPPAPPPPPAPSPPPAP 337 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPP-LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP + P PP PP P P P P PP P P P Sbjct: 252 PKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTPVPLP 297 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPPPP P PPP PPP P + P Sbjct: 319 PPPPPAPP----PPPAPSPPPAPATSSRRP 344 Score = 32.3 bits (70), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXP 454 PPPP PP P P PP P Sbjct: 320 PPPPAPPPPPAPSPPPAP 337 Score = 32.3 bits (70), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXP 453 PPPP PP P P PP P Sbjct: 320 PPPPAPPPPPAPSPPPAP 337 Score = 31.5 bits (68), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPP 465 L PPP PPPP P PPP P Sbjct: 318 LPPPPPAPPPPP--APSPPPAP 337 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 PP PPP P PPP PP P P P Sbjct: 319 PP--PPPAPPPPPAPSPPPAPATSSRRPLLLRAP 350 Score = 31.1 bits (67), Expect(2) = 0.075 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP 486 P PP PPP P P PP P Sbjct: 319 PPPPPAPPPPPAPSPPPAP 337 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 502 PPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 PPP P PPPPP P P P P L Sbjct: 319 PPP--PPAPPPPPAPSPPPAPATSSRRPLL 346 Score = 25.0 bits (52), Expect(2) = 0.075 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPP P P P PP P P Sbjct: 368 PPPLGAPEAPEPEPPPADDSPAEPEP 393 >AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens cDNA FLJ90750 fis, clone PLACE2000118, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG. ). Length = 169 Score = 54.8 bits (126), Expect = 4e-07 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P PPP P PPPP P PPPP PPP P Sbjct: 29 PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPGP 73 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXP 408 P PPL P PPPP PP PPPPP P PPP P Sbjct: 51 PPPPLSQPTGGAPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKP 97 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 9/60 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---------PXXPPPXPXXXXKXPF 384 PP PP P P P P PPPPPP PPP P PPP P PF Sbjct: 20 PPPSPPSFP-PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPGPPPPPF 78 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP----PXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP P P PPPP P PP P PPP Sbjct: 25 PSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPP 71 Score = 41.9 bits (94), Expect = 0.003 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPP P P PP P Sbjct: 22 PSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPGPPPP 76 Score = 41.1 bits (92), Expect = 0.005 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXP 354 P PPP P PP PP P P PPPP PP P S P Sbjct: 5 PPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPP 64 Query: 353 XXXXXXPXP 327 P P Sbjct: 65 PPPPPPPGP 73 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P PPP P PPPP P PPPP Sbjct: 40 PPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPGPPPPP 77 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP----PPXXPRXPXPPXPXXPPP 415 P P P PPPP P PP P PP P P P PPP Sbjct: 5 PPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPP 53 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PP PPPP P PP P P P PP P P Sbjct: 6 PPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYP 48 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXP 419 P P P P P P PPPP P PPPP P P P P Sbjct: 10 PVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPP 69 Query: 418 P 416 P Sbjct: 70 P 70 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXPP 418 P PP PP P PPPPPP P PP P P Sbjct: 16 PGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQP 58 Score = 35.5 bits (78), Expect = 0.26 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP PPPP P PPP P P PP P P Sbjct: 31 PDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPP---PPPPPPGPPPPP 77 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PP PPPP P PPP PP P PPL Sbjct: 39 PPPPPAADYPTLPPPPLSQPTGGAPPPP--PPPPPGPPPPPFTGADGQPAIPPPL 91 >AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. Length = 1584 Score = 54.8 bits (126), Expect = 4e-07 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP PP PP PPPPPP P PPPP P P Sbjct: 1393 PPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPP 1437 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P PPPP PP P PPP P PP P P Sbjct: 1407 PPAQPPPPPPPPPP--PPQQPLPPP--PNLEPAPPSLGDPGEP 1445 Score = 43.6 bits (98), Expect = 0.001 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPP PPPPP P P PP PP Sbjct: 1389 PARSPPSRQPPSGGPPEAPPAQPPPPPP-----PPPPPPQQPLPPPPNLEPAPP 1437 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -1 Query: 533 PLXPPPXPXPP---PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP PP PP PPPPP P PPP P P Sbjct: 1389 PARSPPSRQPPSGGPPEAPPAQPPPPPPPP-----PPPPQQPLPP 1428 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PPP P PPP P PP P P P P P Sbjct: 1408 PAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDPGEPAAHP 1449 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPP--PPPPXXPRXPXPPXPXXP 421 P PP PPPP PP PP P PP P PP P Sbjct: 1398 PPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDP 1442 Score = 36.7 bits (81), Expect = 0.11 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PP P PPPP P PP P P P Sbjct: 1415 PPPPPPPPQQPLPPPPNLEPAPPSLGDPGEPAAHPGPSTGP 1455 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 503 PPPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP PP PP P PPPP PPP P P Sbjct: 1393 PPSRQPPSGGPPEAPPAQP----PPPPPPPPPPPQQPLPPP 1429 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P P PP P PPPP P PPPP P P Sbjct: 1393 PPSRQPPSGGP------PEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAP 1436 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P P PP P PP P P P Sbjct: 1411 PPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDPGEPAAHPGPSTGP 1455 Score = 32.7 bits (71), Expect = 1.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -1 Query: 500 PPXXPPXPPPP---PPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP PP P PPPP PPP P P Sbjct: 1389 PARSPPSRQPPSGGPPEAPPAQPPPPP--PPPPPPPQQPLP 1427 Score = 32.7 bits (71), Expect = 1.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP----PPPPPXXPRXPXPPXPXXP 421 P P PPPP PP P PPPP P P P P Sbjct: 1399 PSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDPGEP 1445 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPX-XPXPP----PPPPXXXPXP 446 P P P P PP P PPPP P PP P P P P Sbjct: 1403 PPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDPGEPAAHPGP 1451 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 54.4 bits (125), Expect = 5e-07 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PPPP PPPPPP PPP PP P Sbjct: 312 PKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Score = 53.2 bits (122), Expect = 1e-06 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P P PP P PPP P PPPP P PPPP PPP P PF Sbjct: 357 PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPP--PPPPPPGPPPPPF 407 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPL P PPPP PP PPP PP P P PPP Sbjct: 379 PPPPLSQPTGGAPPPP--PPPPPPGPPPPPFTGADGQPAIPPP 419 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-----PXXPPP 414 P PPL PP P P P PPPPPP PPP P PPP Sbjct: 302 PAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPP 349 Score = 44.8 bits (101), Expect = 4e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 10/52 (19%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXX-----PPXPPPPP--PXXPXXXXPPPPXXPP 417 P PP PPP P PPPP P PP PP P P PPPP PP Sbjct: 320 PAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPP 371 Score = 44.8 bits (101), Expect = 4e-04 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXPRXPXPP---- 436 P P P P PP PPPP P PPPPPP P P PP Sbjct: 350 PSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTG 409 Query: 435 ---XPXXPPP 415 P PPP Sbjct: 410 ADGQPAIPPP 419 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXPXXXXKXP 387 PP PP P P P P PPPPPP PPPP PPP P P Sbjct: 348 PPPSPPSFP-PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGP 402 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PPPP PPPPPP P P P P Sbjct: 301 PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPP 353 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP PPPP P PP P P P PP P P Sbjct: 318 PPPAPPPPPPPMIGIPPPP-PPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYP 376 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P PP P P P PPPPPP P PP P + P FP Sbjct: 301 PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Score = 38.7 bits (86), Expect = 0.028 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFX 363 P P PP PP P PPP PP P PP PP P S F Sbjct: 297 PSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Query: 362 XXPXXXXXXPXP 327 P P P Sbjct: 357 PHPDFAAPPPPP 368 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXP 419 P P P P P P PPPP P PPPP P P P P Sbjct: 338 PVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPP 397 Query: 418 P 416 P Sbjct: 398 P 398 Score = 37.5 bits (83), Expect = 0.065 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPX-----PPPP---PPXXXPXPXPPXPXXXPP 416 P PP P PPPP PPPP P P P PP P PP Sbjct: 353 PSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPP 403 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXPP 418 P PP PP P PPPPPP P PP P P Sbjct: 344 PGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQP 386 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P PP PP P PPP PP P P P PPP TP Sbjct: 297 PSHPPPAPPLGSPPGPKPGFAPPPAPPPPP-PPMIGIPPPPPPVGFGSPGTP 347 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP PPPP P PPP P P PP PP Sbjct: 359 PDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPP---PPPPPPPGPPPPP 406 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 54.4 bits (125), Expect = 5e-07 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PPPP PPPPPP PPP PP P Sbjct: 312 PKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Score = 53.2 bits (122), Expect = 1e-06 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P P PP P PPP P PPPP P PPPP PPP P PF Sbjct: 357 PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPP--PPPPPPGPPPPPF 407 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPL P PPPP PP PPP PP P P PPP Sbjct: 379 PPPPLSQPTGGAPPPP--PPPPPPGPPPPPFTGADGQPAIPPP 419 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-----PXXPPP 414 P PPL PP P P P PPPPPP PPP P PPP Sbjct: 302 PAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPP 349 Score = 44.8 bits (101), Expect = 4e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 10/52 (19%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXX-----PPXPPPPP--PXXPXXXXPPPPXXPP 417 P PP PPP P PPPP P PP PP P P PPPP PP Sbjct: 320 PAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPP 371 Score = 44.8 bits (101), Expect = 4e-04 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXPRXPXPP---- 436 P P P P PP PPPP P PPPPPP P P PP Sbjct: 350 PSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTG 409 Query: 435 ---XPXXPPP 415 P PPP Sbjct: 410 ADGQPAIPPP 419 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXPXXXXKXP 387 PP PP P P P P PPPPPP PPPP PPP P P Sbjct: 348 PPPSPPSFP-PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGP 402 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PPPP PPPPPP P P P P Sbjct: 301 PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPP 353 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP PPPP P PP P P P PP P P Sbjct: 318 PPPAPPPPPPPMIGIPPPP-PPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYP 376 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P PP P P P PPPPPP P PP P + P FP Sbjct: 301 PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Score = 38.7 bits (86), Expect = 0.028 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFX 363 P P PP PP P PPP PP P PP PP P S F Sbjct: 297 PSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Query: 362 XXPXXXXXXPXP 327 P P P Sbjct: 357 PHPDFAAPPPPP 368 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXP 419 P P P P P P PPPP P PPPP P P P P Sbjct: 338 PVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPP 397 Query: 418 P 416 P Sbjct: 398 P 398 Score = 37.5 bits (83), Expect = 0.065 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPX-----PPPP---PPXXXPXPXPPXPXXXPP 416 P PP P PPPP PPPP P P P PP P PP Sbjct: 353 PSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPP 403 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXPP 418 P PP PP P PPPPPP P PP P P Sbjct: 344 PGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQP 386 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P PP PP P PPP PP P P P PPP TP Sbjct: 297 PSHPPPAPPLGSPPGPKPGFAPPPAPPPPP-PPMIGIPPPPPPVGFGSPGTP 347 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP PPPP P PPP P P PP PP Sbjct: 359 PDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPP---PPPPPPPGPPPPP 406 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 54.4 bits (125), Expect = 5e-07 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PPPP PPPPPP PPP PP P Sbjct: 312 PKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Score = 53.2 bits (122), Expect = 1e-06 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P P PP P PPP P PPPP P PPPP PPP P PF Sbjct: 357 PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPP--PPPPPPGPPPPPF 407 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPL P PPPP PP PPP PP P P PPP Sbjct: 379 PPPPLSQPTGGAPPPP--PPPPPPGPPPPPFTGADGQPAIPPP 419 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-----PXXPPP 414 P PPL PP P P P PPPPPP PPP P PPP Sbjct: 302 PAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPP 349 Score = 44.8 bits (101), Expect = 4e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 10/52 (19%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXX-----PPXPPPPP--PXXPXXXXPPPPXXPP 417 P PP PPP P PPPP P PP PP P P PPPP PP Sbjct: 320 PAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPP 371 Score = 44.8 bits (101), Expect = 4e-04 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXPRXPXPP---- 436 P P P P PP PPPP P PPPPPP P P PP Sbjct: 350 PSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTG 409 Query: 435 ---XPXXPPP 415 P PPP Sbjct: 410 ADGQPAIPPP 419 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXPXXXXKXP 387 PP PP P P P P PPPPPP PPPP PPP P P Sbjct: 348 PPPSPPSFP-PHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGP 402 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PPPP PPPPPP P P P P Sbjct: 301 PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPP 353 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP PPPP P PP P P P PP P P Sbjct: 318 PPPAPPPPPPPMIGIPPPP-PPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYP 376 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P PP P P P PPPPPP P PP P + P FP Sbjct: 301 PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Score = 38.7 bits (86), Expect = 0.028 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFX 363 P P PP PP P PPP PP P PP PP P S F Sbjct: 297 PSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFP 356 Query: 362 XXPXXXXXXPXP 327 P P P Sbjct: 357 PHPDFAAPPPPP 368 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXP 419 P P P P P P PPPP P PPPP P P P P Sbjct: 338 PVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPP 397 Query: 418 P 416 P Sbjct: 398 P 398 Score = 37.5 bits (83), Expect = 0.065 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPX-----PPPP---PPXXXPXPXPPXPXXXPP 416 P PP P PPPP PPPP P P P PP P PP Sbjct: 353 PSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPP 403 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP-XPPXPXXPP 418 P PP PP P PPPPPP P PP P P Sbjct: 344 PGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQP 386 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P PP PP P PPP PP P P P PPP TP Sbjct: 297 PSHPPPAPPLGSPPGPKPGFAPPPAPPPPP-PPMIGIPPPPPPVGFGSPGTP 347 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP PPPP P PPP P P PP PP Sbjct: 359 PDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPP---PPPPPPPGPPPPP 406 >BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 54.0 bits (124), Expect = 7e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P PPP PP PPP PPP P P PP PPP P Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP---PAPPGIPPPRP 504 Score = 46.8 bits (106), Expect = 1e-04 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + PP P PPP PP PP PP P P PP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP P PPP PP PPP P PR P P P PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPP-PRLPPPAPPGIPPP 502 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPP--PPXXPPP 414 P P L P P P PPP PP PP PP P PP PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAP 519 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PPP P P P PP Sbjct: 468 PGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP-XPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PPL PPP P PP P PP PPP P PP P P P P Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGP 462 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPP 414 P P P P PP PP PP PP P P PPP PPP Sbjct: 445 PGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXPXXXXKXP 387 PP+ PP P PPP P PP PP P P PP PP P P Sbjct: 405 PPMPGPP-PLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 39.9 bits (89), Expect = 0.012 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXP--PXPX 428 P P P P P PP P PPP P P PPP P P P P P Sbjct: 453 PLPRLLPPGPPPGRPPGP--PPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Query: 427 XXPPL 413 PPL Sbjct: 511 LVPPL 515 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PPP P PP PP P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPP 435 Score = 38.3 bits (85), Expect = 0.037 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 14/66 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPX------------PPPPPPXXPXXXXPPPPXXPPPXPX 405 P PP PP P P PP PP PP PPP P P PP PP P Sbjct: 424 PGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPP 483 Query: 404 XXXKXP 387 P Sbjct: 484 PRGPPP 489 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPPPP----PXXPXXXXPPPPXXPPPXP 408 PP PP P P PPP P PPP P P P PP PP P Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXX-PPXXXXXXPXPPPPXXPX--PPPPPPXXXPXP-XPPXPXXXPP 416 P P P P PP P PPP P PP PPP P PP P PP Sbjct: 444 PPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPP 501 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 507 PPPPXXPPX-PPPPPPXXPRXPXPPXPXXPPP 415 PP P PP PPP PP P P P PPP Sbjct: 405 PPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPP 436 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPP-PXP 408 P PP PP PPP PP PPP PP P PP PP P P Sbjct: 480 PGPPPRGPPPRLPPP--APPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLP 529 Score = 36.3 bits (80), Expect = 0.15 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 17/60 (28%) Frame = -1 Query: 542 PXPPLXPPPXP---XP-PPPXXPPXPPPP-------------PPXXPXXXXPPPPXXPPP 414 P PPL PP P P PPP PP PP PP P P PP PPP Sbjct: 417 PAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPP 476 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PP PPP P R P P P P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP--XPXXXPP 416 P P P P PPP P PP PP P PP P PP Sbjct: 394 PQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPP 445 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPP--PXXXPXPXPPXPXXXPP 416 P PP P P PP PP PP P P PP P P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAP 439 Score = 33.5 bits (73), Expect = 1.1 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP---PPXXPPXPPP------PPPXXPRXPXPPXPXXPPP 415 P P PP PP PP P PPP PP P P PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP PPP PPP P P PP P Sbjct: 462 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPG 521 Query: 415 L 413 L Sbjct: 522 L 522 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP-PPPXXXPXPXP----PXPXXXPP 416 P P PP P PP P PPP PP P P P P PP Sbjct: 406 PMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPP 460 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP--PPPXXPPX--P--PPPPPXXPRXP-XPPXPXXPP 418 P P PP P PPP PP P PPP P R P PP PP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXP-----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP P P PP PP P PP P P P P Sbjct: 492 PPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAP 537 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP--XPPXPXXXP 419 P P P PP P PP P PP PP P PP P P Sbjct: 482 PPPRGPPPRLPPPAPPGIP-PPRPGMMRPPLVPPLGPAPPGLFPPAPLPNP 531 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PP P P PP Sbjct: 494 PAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPP 538 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P P PPP PP P P P P PP Sbjct: 440 PFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPP 484 >BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. Length = 400 Score = 54.0 bits (124), Expect = 7e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P PPP PP PPP PPP P P PP PPP P Sbjct: 219 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP---PAPPGIPPPRP 263 Score = 46.8 bits (106), Expect = 1e-04 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + PP P PPP PP PP PP P P PP PP Sbjct: 157 PPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 199 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP P PPP PP PPP P PR P P P PPP Sbjct: 219 PGPPPGRPPGPPPGPPPGLPPGPPPRGPP-PRLPPPAPPGIPPP 261 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPP--PPXXPPP 414 P P L P P P PPP PP PP PP P PP PP P P Sbjct: 233 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAP 278 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PPP P P P PP Sbjct: 227 PGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 269 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP-XPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PPL PPP P PP P PP PPP P PP P P P P Sbjct: 170 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGP 221 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPP 414 P P P P PP PP PP PP P P PPP PPP Sbjct: 204 PGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 248 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXPXXXXKXP 387 PP+ PP P PPP P PP PP P P PP PP P P Sbjct: 164 PPMPGPP-PLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 214 Score = 39.9 bits (89), Expect = 0.012 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXP--PXPX 428 P P P P P PP P PPP P P PPP P P P P P Sbjct: 212 PLPRLLPPGPPPGRPPGP--PPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 269 Query: 427 XXPPL 413 PPL Sbjct: 270 LVPPL 274 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PPP P PP PP P Sbjct: 152 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPP 194 Score = 38.3 bits (85), Expect = 0.037 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 14/66 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPX------------PPPPPPXXPXXXXPPPPXXPPPXPX 405 P PP PP P P PP PP PP PPP P P PP PP P Sbjct: 183 PGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPP 242 Query: 404 XXXKXP 387 P Sbjct: 243 PRGPPP 248 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPPPP----PXXPXXXXPPPPXXPPPXP 408 PP PP P P PPP P PPP P P P PP PP P Sbjct: 238 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 286 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXX-PPXXXXXXPXPPPPXXPX--PPPPPPXXXPXP-XPPXPXXXPP 416 P P P P PP P PPP P PP PPP P PP P PP Sbjct: 203 PPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPP 260 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 507 PPPPXXPPX-PPPPPPXXPRXPXPPXPXXPPP 415 PP P PP PPP PP P P P PPP Sbjct: 164 PPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPP 195 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPP-PXP 408 P PP PP PPP PP PPP PP P PP PP P P Sbjct: 239 PGPPPRGPPPRLPPP--APPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLP 288 Score = 36.3 bits (80), Expect = 0.15 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 17/60 (28%) Frame = -1 Query: 542 PXPPLXPPPXP---XP-PPPXXPPXPPPP-------------PPXXPXXXXPPPPXXPPP 414 P PPL PP P P PPP PP PP PP P P PP PPP Sbjct: 176 PAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPP 235 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PP PPP P R P P P P Sbjct: 169 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 214 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP--XPXXXPP 416 P P P P PPP P PP PP P PP P PP Sbjct: 153 PQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPP 204 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPP--PXXXPXPXPPXPXXXPP 416 P PP P P PP PP PP P P PP P P Sbjct: 152 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAP 198 Score = 33.5 bits (73), Expect = 1.1 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP---PPXXPPXPPP------PPPXXPRXPXPPXPXXPPP 415 P P PP PP PP P PPP PP P P PP P P Sbjct: 233 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 286 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP PPP PPP P P PP P Sbjct: 221 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPG 280 Query: 415 L 413 L Sbjct: 281 L 281 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP-PPPXXXPXPXP----PXPXXXPP 416 P P PP P PP P PPP PP P P P P PP Sbjct: 165 PMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPP 219 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP--PPPXXPPX--P--PPPPPXXPRXP-XPPXPXXPP 418 P P PP P PPP PP P PPP P R P PP PP Sbjct: 229 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 279 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXP-----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP P P PP PP P PP P P P P Sbjct: 251 PPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAP 296 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP--XPPXPXXXP 419 P P P PP P PP P PP PP P PP P P Sbjct: 241 PPPRGPPPRLPPPAPPGIP-PPRPGMMRPPLVPPLGPAPPGLFPPAPLPNP 290 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PP P P PP Sbjct: 253 PAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPP 297 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P P PPP PP P P P P PP Sbjct: 199 PFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPP 243 >BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 54.0 bits (124), Expect = 7e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P PPP PP PPP PPP P P PP PPP P Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP---PAPPGIPPPRP 504 Score = 46.8 bits (106), Expect = 1e-04 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + PP P PPP PP PP PP P P PP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP P PPP PP PPP P PR P P P PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPP-PRLPPPAPPGIPPP 502 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPP--PPXXPPP 414 P P L P P P PPP PP PP PP P PP PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAP 519 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PPP P P P PP Sbjct: 468 PGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP-XPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PPL PPP P PP P PP PPP P PP P P P P Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGP 462 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPP 414 P P P P PP PP PP PP P P PPP PPP Sbjct: 445 PGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXPXXXXKXP 387 PP+ PP P PPP P PP PP P P PP PP P P Sbjct: 405 PPMPGPP-PLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 39.9 bits (89), Expect = 0.012 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXP--PXPX 428 P P P P P PP P PPP P P PPP P P P P P Sbjct: 453 PLPRLLPPGPPPGRPPGP--PPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Query: 427 XXPPL 413 PPL Sbjct: 511 LVPPL 515 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PPP P PP PP P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPP 435 Score = 38.3 bits (85), Expect = 0.037 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 14/66 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPX------------PPPPPPXXPXXXXPPPPXXPPPXPX 405 P PP PP P P PP PP PP PPP P P PP PP P Sbjct: 424 PGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPP 483 Query: 404 XXXKXP 387 P Sbjct: 484 PRGPPP 489 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPPPP----PXXPXXXXPPPPXXPPPXP 408 PP PP P P PPP P PPP P P P PP PP P Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXX-PPXXXXXXPXPPPPXXPX--PPPPPPXXXPXP-XPPXPXXXPP 416 P P P P PP P PPP P PP PPP P PP P PP Sbjct: 444 PPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPP 501 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 507 PPPPXXPPX-PPPPPPXXPRXPXPPXPXXPPP 415 PP P PP PPP PP P P P PPP Sbjct: 405 PPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPP 436 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPP-PXP 408 P PP PP PPP PP PPP PP P PP PP P P Sbjct: 480 PGPPPRGPPPRLPPP--APPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLP 529 Score = 36.3 bits (80), Expect = 0.15 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 17/60 (28%) Frame = -1 Query: 542 PXPPLXPPPXP---XP-PPPXXPPXPPPP-------------PPXXPXXXXPPPPXXPPP 414 P PPL PP P P PPP PP PP PP P P PP PPP Sbjct: 417 PAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPP 476 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PP PPP P R P P P P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP--XPXXXPP 416 P P P P PPP P PP PP P PP P PP Sbjct: 394 PQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPP 445 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPP--PXXXPXPXPPXPXXXPP 416 P PP P P PP PP PP P P PP P P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAP 439 Score = 33.5 bits (73), Expect = 1.1 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP---PPXXPPXPPP------PPPXXPRXPXPPXPXXPPP 415 P P PP PP PP P PPP PP P P PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP PPP PPP P P PP P Sbjct: 462 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPG 521 Query: 415 L 413 L Sbjct: 522 L 522 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP-PPPXXXPXPXP----PXPXXXPP 416 P P PP P PP P PPP PP P P P P PP Sbjct: 406 PMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPP 460 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP--PPPXXPPX--P--PPPPPXXPRXP-XPPXPXXPP 418 P P PP P PPP PP P PPP P R P PP PP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXP-----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP P P PP PP P PP P P P P Sbjct: 492 PPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAP 537 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP--XPPXPXXXP 419 P P P PP P PP P PP PP P PP P P Sbjct: 482 PPPRGPPPRLPPPAPPGIP-PPRPGMMRPPLVPPLGPAPPGLFPPAPLPNP 531 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PP P P PP Sbjct: 494 PAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPP 538 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P P PPP PP P P P P PP Sbjct: 440 PFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPP 484 >AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding protein SNP70 protein. Length = 641 Score = 54.0 bits (124), Expect = 7e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P PPP PP PPP PPP P P PP PPP P Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP---PAPPGIPPPRP 504 Score = 46.8 bits (106), Expect = 1e-04 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + PP P PPP PP PP PP P P PP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP P PPP PP PPP P PR P P P PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPP-PRLPPPAPPGIPPP 502 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPP--PPXXPPP 414 P P L P P P PPP PP PP PP P PP PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAP 519 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PPP P P P PP Sbjct: 468 PGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP-XPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PPL PPP P PP P PP PPP P PP P P P P Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGP 462 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPP 414 P P P P PP PP PP PP P P PPP PPP Sbjct: 445 PGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXPXXXXKXP 387 PP+ PP P PPP P PP PP P P PP PP P P Sbjct: 405 PPMPGPP-PLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 39.9 bits (89), Expect = 0.012 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXP--PXPX 428 P P P P P PP P PPP P P PPP P P P P P Sbjct: 453 PLPRLLPPGPPPGRPPGP--PPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Query: 427 XXPPL 413 PPL Sbjct: 511 LVPPL 515 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PPP P PP PP P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPP 435 Score = 38.3 bits (85), Expect = 0.037 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 14/66 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPX------------PPPPPPXXPXXXXPPPPXXPPPXPX 405 P PP PP P P PP PP PP PPP P P PP PP P Sbjct: 424 PGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPP 483 Query: 404 XXXKXP 387 P Sbjct: 484 PRGPPP 489 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPPPP----PXXPXXXXPPPPXXPPPXP 408 PP PP P P PPP P PPP P P P PP PP P Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXX-PPXXXXXXPXPPPPXXPX--PPPPPPXXXPXP-XPPXPXXXPP 416 P P P P PP P PPP P PP PPP P PP P PP Sbjct: 444 PPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPP 501 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 507 PPPPXXPPX-PPPPPPXXPRXPXPPXPXXPPP 415 PP P PP PPP PP P P P PPP Sbjct: 405 PPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPP 436 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPP-PXP 408 P PP PP PPP PP PPP PP P PP PP P P Sbjct: 480 PGPPPRGPPPRLPPP--APPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLP 529 Score = 36.3 bits (80), Expect = 0.15 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 17/60 (28%) Frame = -1 Query: 542 PXPPLXPPPXP---XP-PPPXXPPXPPPP-------------PPXXPXXXXPPPPXXPPP 414 P PPL PP P P PPP PP PP PP P P PP PPP Sbjct: 417 PAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPP 476 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PP PPP P R P P P P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP--XPXXXPP 416 P P P P PPP P PP PP P PP P PP Sbjct: 394 PQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPP 445 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPP--PXXXPXPXPPXPXXXPP 416 P PP P P PP PP PP P P PP P P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAP 439 Score = 33.5 bits (73), Expect = 1.1 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP---PPXXPPXPPP------PPPXXPRXPXPPXPXXPPP 415 P P PP PP PP P PPP PP P P PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP PPP PPP P P PP P Sbjct: 462 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPG 521 Query: 415 L 413 L Sbjct: 522 L 522 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP-PPPXXXPXPXP----PXPXXXPP 416 P P PP P PP P PPP PP P P P P PP Sbjct: 406 PMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPP 460 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP--PPPXXPPX--P--PPPPPXXPRXP-XPPXPXXPP 418 P P PP P PPP PP P PPP P R P PP PP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXP-----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP P P PP PP P PP P P P P Sbjct: 492 PPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAP 537 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP--XPPXPXXXP 419 P P P PP P PP P PP PP P PP P P Sbjct: 482 PPPRGPPPRLPPPAPPGIP-PPRPGMMRPPLVPPLGPAPPGLFPPAPLPNP 531 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PP P P PP Sbjct: 494 PAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPP 538 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P P PPP PP P P P P PP Sbjct: 440 PFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPP 484 >AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein NpwBP protein. Length = 641 Score = 54.0 bits (124), Expect = 7e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P PPP PP PPP PPP P P PP PPP P Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP---PAPPGIPPPRP 504 Score = 46.8 bits (106), Expect = 1e-04 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + PP P PPP PP PP PP P P PP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPP 440 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 543 PXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP P PPP PP PPP P PR P P P PPP Sbjct: 460 PGPPPGRPPGPPPGPPPGLPPGPPPRGPP-PRLPPPAPPGIPPP 502 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPP--PPXXPPP 414 P P L P P P PPP PP PP PP P PP PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAP 519 Score = 43.2 bits (97), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PPP P P P PP Sbjct: 468 PGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPP-XPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PPL PPP P PP P PP PPP P PP P P P P Sbjct: 411 PPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGP 462 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPP 414 P P P P PP PP PP PP P P PPP PPP Sbjct: 445 PGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPP 489 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXPXXXXKXP 387 PP+ PP P PPP P PP PP P P PP PP P P Sbjct: 405 PPMPGPP-PLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 39.9 bits (89), Expect = 0.012 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXP--PXPX 428 P P P P P PP P PPP P P PPP P P P P P Sbjct: 453 PLPRLLPPGPPPGRPPGP--PPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPP 510 Query: 427 XXPPL 413 PPL Sbjct: 511 LVPPL 515 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P PPP P PP PP P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPP 435 Score = 38.3 bits (85), Expect = 0.037 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 14/66 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPX------------PPPPPPXXPXXXXPPPPXXPPPXPX 405 P PP PP P P PP PP PP PPP P P PP PP P Sbjct: 424 PGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPP 483 Query: 404 XXXKXP 387 P Sbjct: 484 PRGPPP 489 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPPPP----PXXPXXXXPPPPXXPPPXP 408 PP PP P P PPP P PPP P P P PP PP P Sbjct: 479 PPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXX-PPXXXXXXPXPPPPXXPX--PPPPPPXXXPXP-XPPXPXXXPP 416 P P P P PP P PPP P PP PPP P PP P PP Sbjct: 444 PPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPP 501 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 507 PPPPXXPPX-PPPPPPXXPRXPXPPXPXXPPP 415 PP P PP PPP PP P P P PPP Sbjct: 405 PPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPP 436 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP------PPXXPXXXXPPPPXXPP-PXP 408 P PP PP PPP PP PPP PP P PP PP P P Sbjct: 480 PGPPPRGPPPRLPPP--APPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLP 529 Score = 36.3 bits (80), Expect = 0.15 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 17/60 (28%) Frame = -1 Query: 542 PXPPLXPPPXP---XP-PPPXXPPXPPPP-------------PPXXPXXXXPPPPXXPPP 414 P PPL PP P P PPP PP PP PP P P PP PPP Sbjct: 417 PAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPP 476 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP-PPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PP PPP P R P P P P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLP 455 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP--XPXXXPP 416 P P P P PPP P PP PP P PP P PP Sbjct: 394 PQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPP 445 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPP--PXXXPXPXPPXPXXXPP 416 P PP P P PP PP PP P P PP P P Sbjct: 393 PPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAP 439 Score = 33.5 bits (73), Expect = 1.1 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPP---PPXXPPXPPP------PPPXXPRXPXPPXPXXPPP 415 P P PP PP PP P PPP PP P P PP P P Sbjct: 474 PPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAP 527 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP PPP PPP P P PP P Sbjct: 462 PPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPG 521 Query: 415 L 413 L Sbjct: 522 L 522 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP-PPPXXXPXPXP----PXPXXXPP 416 P P PP P PP P PPP PP P P P P PP Sbjct: 406 PMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPP 460 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = -3 Query: 549 PXPXXPPXXXXXXXP--PPPXXPPX--P--PPPPPXXPRXP-XPPXPXXPP 418 P P PP P PPP PP P PPP P R P PP PP Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPP 520 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPXP-----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP P P PP PP P PP P P P P Sbjct: 492 PPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAP 537 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP--XPPXPXXXP 419 P P P PP P PP P PP PP P PP P P Sbjct: 482 PPPRGPPPRLPPPAPPGIP-PPRPGMMRPPLVPPLGPAPPGLFPPAPLPNP 531 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXP--PPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PPP P PP P P PP P P PP Sbjct: 494 PAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPP 538 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P P PPP PP P P P P PP Sbjct: 440 PFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPP 484 >U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc finger protein protein. Length = 2004 Score = 53.6 bits (123), Expect = 9e-07 Identities = 23/51 (45%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PP P PPPP P P PPPP P P P PPP P + P Sbjct: 1651 PPPPPPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQPP 1701 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 PP P PPPP P PPPP P P P PP Sbjct: 1643 PPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPP 1675 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXP-PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP P P PPPP P+ P P PPP PL Sbjct: 1652 PPPPPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQPPL 1702 Score = 40.3 bits (90), Expect = 0.009 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PPPP P P P PP P PPL Sbjct: 1652 PPPPPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQPPL 1702 Score = 39.9 bits (89), Expect = 0.012 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P PP P P P P PPPP P P P P P PP Sbjct: 1644 PSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPP 1695 Score = 36.3 bits (80), Expect = 0.15 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P P P P PP P P PPPPPP P Sbjct: 1653 PPPPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQP 1700 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P P P P P P PP PPPP P Sbjct: 1655 PPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQPP 1701 >M98776-1|AAB47721.1| 644|Homo sapiens keratin 1 protein. Length = 644 Score = 52.4 bits (120), Expect = 2e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GGG GG G GG G GGG GG G Sbjct: 93 GYGGGGFGGGGFGGGGFGGGGIGGGGFGG-FGSGGGGFGGGGFGGGG 138 Score = 52.0 bits (119), Expect = 3e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 G GGG GGGG G GGG GG G GG GG G GGG GG Sbjct: 98 GFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGG 141 Score = 48.4 bits (110), Expect = 3e-05 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GG G G G GG G GGG GG G Sbjct: 89 GFGGGY-GGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGG 133 Score = 47.2 bits (107), Expect = 8e-05 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG G GG GGGG G GGG GG G Sbjct: 103 GFGGGGFGGGGIGGGGF--GGFGSGGGGFGGGGFG-GGGYGGGYG 144 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXG--GGXRGGXG 543 G GGG G G G G GG GGG GG GG G G G GG GG G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRG 617 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GGGG GG GGGG G G GG G Sbjct: 85 GRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFG 130 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGGXG 543 G G G GGG G GGG GG G GG GG G GG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGG 128 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G GGGG G G GGGG G GG G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GG G G GGG GG G GGGG G GG G G G G Sbjct: 91 GGGYGGGGFGGGGFGGGGFGGGGI-GGGGFGGFGSGGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGG GG G GGGG GG G G Sbjct: 100 GGGGFGGGGFGGGGIGGGGFGGFGS--GGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G GG GG GG GG GG G GGG GG Sbjct: 567 GSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGG 611 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 +G G GG G GG G GGGGGG G GG G GGG G G Sbjct: 518 RGGGGGGYGSGGSSYGSGG-GSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGG 570 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGG G G GGGG G G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGG 137 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G GG G G G G GGG G G Sbjct: 533 GSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G G GG G GGGG G GG G G Sbjct: 560 GSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGG 607 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G G GGG G GGGG G G GG Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGG 556 Score = 40.7 bits (91), Expect = 0.007 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG G GGG G GGG GG G Sbjct: 514 GGGSRGGGG----GGYGSGGSSYGS--GGGSYGSGGGGGGGRG 550 Score = 40.7 bits (91), Expect = 0.007 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXG--XXGGGGGGXGGXXGGGGXG------XGGGXRGGXG 543 G GGG GG G G G GGG G GGGG G GG RGG G Sbjct: 540 GSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSG 592 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG--GGGXGGXXGGGGXXXXXXXGG 535 GGG G GG G G GGG GGG GG GGG GG Sbjct: 110 GGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGYGPVCPPGG 151 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGG G G GGG GG GG G GG G Sbjct: 589 GGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 39.1 bits (87), Expect = 0.021 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGGGGXG-----GXXGGGGXGXGGGXRGGXG 543 G GG G GGG G GGG G G G GG G GGG GG G Sbjct: 553 GSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRG 603 Score = 37.5 bits (83), Expect = 0.065 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G G GGGG GG GGG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGG 126 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GG G GGGG GG G G G G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGG-GGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXX--GGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 GG GGGG G G GGG G G GGGG G G G Sbjct: 515 GGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG 560 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG GGGG G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGG 596 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 440 GXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G RG GGG G G G GG GG G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRG 550 Score = 34.3 bits (75), Expect = 0.60 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +3 Query: 414 RGGXXXGXG------GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G G G G G GGGGG G G G GG G G G Sbjct: 518 RGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGG 574 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G G G G GG G GG G G G G Sbjct: 562 GGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSG 621 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G G G GG G GGG GG G Sbjct: 71 GGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGG 108 Score = 33.9 bits (74), Expect = 0.80 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG-GXGXXGG---GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGGG G GG G G GG G G G G Sbjct: 528 GGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSG 585 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G GG GGG GG G Sbjct: 535 GGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXG--GGGGGXGXXGGGGXG 512 GG G GG G G G GGGG G G GG G Sbjct: 105 GGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXG-XGGGXRGGXG 543 GG GG G G GG G G GG GG GG G GG + G Sbjct: 585 GGYRGGSGGGGGGSSGGRGSG-GGSSGGSIGGRGSSSGGVKSSGG 628 Score = 31.5 bits (68), Expect = 4.2 Identities = 23/95 (24%), Positives = 25/95 (26%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G G + G G + G G G G GG G Sbjct: 521 GGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGS 580 Query: 462 XGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GGGG G G G G Sbjct: 581 GSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGG 615 Score = 31.5 bits (68), Expect = 4.2 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 432 GXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G GG G G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG 600 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGG 536 RGG G GG G GGG G G G GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 +G G G G GG G GG G GG GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 >DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated potassium channel 2 protein. Length = 112 Score = 52.4 bits (120), Expect = 2e-06 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPP 417 P P P P PPPP PP PPPPPP P P PP PP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 512 PXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPPPP P PPPP P P P P Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP PPPPP PPPP PPP P Sbjct: 10 PGESPGATPAPGPP-PPPPPAPPQQQPPPPPPPAPPPGP 47 Score = 40.3 bits (90), Expect = 0.009 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPPP P P P P PP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP PPPP P PPP P P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPP-PPAPPPGPGPAPPQHPPRAEALPP 63 >BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. Length = 268 Score = 52.4 bits (120), Expect = 2e-06 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GG GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGGGGGG 56 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG GG G GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGG 52 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GG GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGGG 53 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/41 (53%), Positives = 22/41 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG G G G GGGGGG GG GGGG G G R Sbjct: 20 GLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 39.5 bits (88), Expect = 0.016 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G GG GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGGGGG 55 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G GG G G G G G Sbjct: 12 GGGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGGGGG 55 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G GG G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGG 52 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G G Sbjct: 11 GGGGGGGGGGLGGGLGGVLGGLIGGAGGGGGGGGGGGGGGGGGG 54 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 389 GVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGG 502 GV GG G GG G G GGGGG GG Sbjct: 27 GVLGGLIGGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 >BC063697-1|AAH63697.1| 644|Homo sapiens keratin 1 (epidermolytic hyperkeratosis) protein. Length = 644 Score = 52.4 bits (120), Expect = 2e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GGG GG G GG G GGG GG G Sbjct: 93 GYGGGGFGGGGFGGGGFGGGGIGGGGFGG-FGSGGGGFGGGGFGGGG 138 Score = 52.0 bits (119), Expect = 3e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 G GGG GGGG G GGG GG G GG GG G GGG GG Sbjct: 98 GFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGG 141 Score = 48.4 bits (110), Expect = 3e-05 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GG G G G GG G GGG GG G Sbjct: 89 GFGGGY-GGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGG 133 Score = 47.2 bits (107), Expect = 8e-05 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG G GG GGGG G GGG GG G Sbjct: 103 GFGGGGFGGGGIGGGGF--GGFGSGGGGFGGGGFG-GGGYGGGYG 144 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXG--GGXRGGXG 543 G GGG G G G G GG GGG GG GG G G G GG GG G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRG 617 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GGGG GG GGGG G G GG G Sbjct: 85 GRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFG 130 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGGXG 543 G G G GGG G GGG GG G GG GG G GG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGG 128 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G GGGG G G GGGG G GG G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GG G G GGG GG G GGGG G GG G G G G Sbjct: 91 GGGYGGGGFGGGGFGGGGFGGGGI-GGGGFGGFGSGGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGG GG G GGGG GG G G Sbjct: 100 GGGGFGGGGFGGGGIGGGGFGGFGS--GGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G GG GG GG GG GG G GGG GG Sbjct: 567 GSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGG 611 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 +G G GG G GG G GGGGGG G GG G GGG G G Sbjct: 518 RGGGGGGYGSGGSSYGSGG-GSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGG 570 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGG G G GGGG G G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGG 137 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G GG G G G G GGG G G Sbjct: 533 GSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G G GG G GGGG G GG G G Sbjct: 560 GSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGG 607 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G G GGG G GGGG G G GG Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGG 556 Score = 40.7 bits (91), Expect = 0.007 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG G GGG G GGG GG G Sbjct: 514 GGGSRGGGG----GGYGSGGSSYGS--GGGSYGSGGGGGGGRG 550 Score = 40.7 bits (91), Expect = 0.007 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXG--XXGGGGGGXGGXXGGGGXG------XGGGXRGGXG 543 G GGG GG G G G GGG G GGGG G GG RGG G Sbjct: 540 GSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSG 592 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG--GGGXGGXXGGGGXXXXXXXGG 535 GGG G GG G G GGG GGG GG GGG GG Sbjct: 110 GGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGYGPVCPPGG 151 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGG G G GGG GG GG G GG G Sbjct: 589 GGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 39.1 bits (87), Expect = 0.021 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGGGGXG-----GXXGGGGXGXGGGXRGGXG 543 G GG G GGG G GGG G G G GG G GGG GG G Sbjct: 553 GSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRG 603 Score = 37.5 bits (83), Expect = 0.065 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G G GGGG GG GGG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGG 126 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GG G GGGG GG G G G G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGG-GGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXX--GGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 GG GGGG G G GGG G G GGGG G G G Sbjct: 515 GGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG 560 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG GGGG G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGG 596 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 440 GXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G RG GGG G G G GG GG G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRG 550 Score = 34.3 bits (75), Expect = 0.60 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +3 Query: 414 RGGXXXGXG------GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G G G G G GGGGG G G G GG G G G Sbjct: 518 RGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGG 574 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G G G G GG G GG G G G G Sbjct: 562 GGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSG 621 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G G G GG G GGG GG G Sbjct: 71 GGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGG 108 Score = 33.9 bits (74), Expect = 0.80 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG-GXGXXGG---GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGGG G GG G G GG G G G G Sbjct: 528 GGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSG 585 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G GG GGG GG G Sbjct: 535 GGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXG--GGGGGXGXXGGGGXG 512 GG G GG G G G GGGG G G GG G Sbjct: 105 GGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXG-XGGGXRGGXG 543 GG GG G G GG G G GG GG GG G GG + G Sbjct: 585 GGYRGGSGGGGGGSSGGRGSG-GGSSGGSIGGRGSSSGGVKSSGG 628 Score = 31.5 bits (68), Expect = 4.2 Identities = 23/95 (24%), Positives = 25/95 (26%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G G + G G + G G G G GG G Sbjct: 521 GGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGS 580 Query: 462 XGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GGGG G G G G Sbjct: 581 GSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGG 615 Score = 31.5 bits (68), Expect = 4.2 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 432 GXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G GG G G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG 600 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGG 536 RGG G GG G GGG G G G GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 +G G G G GG G GG G GG GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 52.4 bits (120), Expect = 2e-06 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PPL PPP P PPPP PP PPPP P Sbjct: 624 PSPPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 50.4 bits (115), Expect = 9e-06 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFF 381 P P + P P P PP PPPPPP P PPPP P P F Sbjct: 611 PQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMF 664 Score = 49.2 bits (112), Expect = 2e-05 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PP PPPPPP P PPPP PPP P Sbjct: 607 PPLSPQPKIVTPYTASQPSPPLPPPPPP--PPPPPPPPPPPPPPLP 650 Score = 46.0 bits (104), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P P PPPPPP P P PP P P Sbjct: 611 PQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 655 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P P PPPP P PPPPPP P P P Sbjct: 601 PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 655 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPPP P PPPPPP P P P+ Sbjct: 613 PKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPM 663 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P+ P P PPP PPPPP P PPPP P Sbjct: 910 PVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASP 948 Score = 40.3 bits (90), Expect = 0.009 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PP P PPP P PPPPPP Sbjct: 906 PSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPP 943 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P PP PPPP P PPPPPP P P P Sbjct: 917 PPPPPESSLVFPPPPPSPVPAPPPPPP-PTASPTPDKSGSP 956 Score = 36.7 bits (81), Expect = 0.11 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 7/79 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP----PPP---PPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P PP PPP P P PP PP P P P P PP PP P + F Sbjct: 761 PTPP-PPPPIPAPLPPQAPPKPLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAF 819 Query: 383 FSXXXFXXXPXXXXXXPXP 327 + P P P Sbjct: 820 PASYIPPSPPTPPVPVPPP 838 Score = 36.3 bits (80), Expect = 0.15 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PP P PPPP P PP PP P P P Sbjct: 760 PPTPPPPPPIPAPLPPQAPP-KPLVTIPAP 788 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PPP PPP P P PPPP P P P Sbjct: 912 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSP 956 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPP P P P P P P PPPP Sbjct: 711 PPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPP 746 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP-XXPPP 415 P P PP PPP PPPPP P P PP P P P Sbjct: 912 PSPDFPP-------PPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 950 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXPXXXXKXP 387 P P P P P PPPPP PPP P PPP P P Sbjct: 896 PAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 950 Score = 34.7 bits (76), Expect = 0.46 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PP PP P P P P PPP TP Sbjct: 912 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 950 Score = 33.9 bits (74), Expect = 0.80 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PP PP P P P+ P P P P Sbjct: 760 PPTPPPPPPIPAPLPPQAPPKPLVTIPAP 788 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P + PP PPP P PPPP P P P P Sbjct: 699 PQILVPPNGVVPPPPPP--PPPPTPGSAMAQLKPAPCAP 735 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 L PP PPPP PP P P P P P PP P Sbjct: 702 LVPPNGVVPPPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPP 746 Score = 31.9 bits (69), Expect = 3.2 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP P P PPP P PPP P P Sbjct: 817 PAFPASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPVP 859 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P P PP P P P Sbjct: 760 PPTPPPPPPIPAPLPP--QAPPKPLVTIPAP 788 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PPP P P P P PPP P Sbjct: 930 PPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPPPTP 975 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 52.4 bits (120), Expect = 2e-06 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PPL PPP P PPPP PP PPPP P Sbjct: 624 PSPPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 50.4 bits (115), Expect = 9e-06 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFF 381 P P + P P P PP PPPPPP P PPPP P P F Sbjct: 611 PQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMF 664 Score = 49.2 bits (112), Expect = 2e-05 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PP PPPPPP P PPPP PPP P Sbjct: 607 PPLSPQPKIVTPYTASQPSPPLPPPPPP--PPPPPPPPPPPPPPLP 650 Score = 46.0 bits (104), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P P PPPPPP P P PP P P Sbjct: 611 PQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 655 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P P PPPP P PPPPPP P P P Sbjct: 601 PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 655 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPPP P PPPPPP P P P+ Sbjct: 613 PKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPM 663 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P+ P P PPP PPPPP P PPPP P Sbjct: 910 PVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASP 948 Score = 40.3 bits (90), Expect = 0.009 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PP P PPP P PPPPPP Sbjct: 906 PSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPP 943 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P PP PPPP P PPPPPP P P P Sbjct: 917 PPPPPESSLVFPPPPPSPVPAPPPPPP-PTASPTPDKSGSP 956 Score = 36.7 bits (81), Expect = 0.11 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 7/79 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP----PPP---PPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P PP PPP P P PP PP P P P P PP PP P + F Sbjct: 761 PTPP-PPPPIPAPLPPQAPPKPLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAF 819 Query: 383 FSXXXFXXXPXXXXXXPXP 327 + P P P Sbjct: 820 PASYIPPSPPTPPVPVPPP 838 Score = 36.3 bits (80), Expect = 0.15 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PP P PPPP P PP PP P P P Sbjct: 760 PPTPPPPPPIPAPLPPQAPP-KPLVTIPAP 788 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PPP PPP P P PPPP P P P Sbjct: 912 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSP 956 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPP P P P P P P PPPP Sbjct: 711 PPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPP 746 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP-XXPPP 415 P P PP PPP PPPPP P P PP P P P Sbjct: 912 PSPDFPP-------PPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 950 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXPXXXXKXP 387 P P P P P PPPPP PPP P PPP P P Sbjct: 896 PAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 950 Score = 34.7 bits (76), Expect = 0.46 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PP PP P P P P PPP TP Sbjct: 912 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 950 Score = 33.9 bits (74), Expect = 0.80 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PP PP P P P+ P P P P Sbjct: 760 PPTPPPPPPIPAPLPPQAPPKPLVTIPAP 788 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P + PP PPP P PPPP P P P P Sbjct: 699 PQILVPPNGVVPPPPPP--PPPPTPGSAMAQLKPAPCAP 735 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 L PP PPPP PP P P P P P PP P Sbjct: 702 LVPPNGVVPPPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPP 746 Score = 31.9 bits (69), Expect = 3.2 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP P P PPP P PPP P P Sbjct: 817 PAFPASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPVP 859 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P P PP P P P Sbjct: 760 PPTPPPPPPIPAPLPP--QAPPKPLVTIPAP 788 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PPP P P P P PPP P Sbjct: 930 PPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPPPTP 975 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 52.4 bits (120), Expect = 2e-06 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPP 417 P P P P PPPP PP PPPPPP P P PP PP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 512 PXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPPPP P PPPP P P P P Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP PPPPP PPPP PPP P Sbjct: 10 PGESPGATPAPGPP-PPPPPAPPQQQPPPPPPPAPPPGP 47 Score = 40.3 bits (90), Expect = 0.009 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPPP P P P P PP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP PPPP P PPP P P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPP-PPAPPPGPGPAPPQHPPRAEALPP 63 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPP 435 P L P P P P P PPPP PP P P Sbjct: 755 PRLVRRPPPGPAPAAASPGPPPPASPPGAPASPRAP 790 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPPPXP 408 PP P P P PPPP PP P P P P P P P Sbjct: 761 PPPGPAPAAASPGPPPPASPPGAPASPRAPRTSPYGGLPAAPLAGPALP 809 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 52.4 bits (120), Expect = 2e-06 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPP 417 P P P P PPPP PP PPPPPP P P PP PP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 512 PXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPPPP P PPPP P P P P Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP PPPPP PPPP PPP P Sbjct: 10 PGESPGATPAPGPP-PPPPPAPPQQQPPPPPPPAPPPGP 47 Score = 40.3 bits (90), Expect = 0.009 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPPP P P P P PP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP PPPP P PPP P P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPP-PPAPPPGPGPAPPQHPPRAEALPP 63 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPP 435 P L P P P P P PPPP PP P P Sbjct: 755 PRLVRRPPPGPAPAAASPGPPPPASPPGAPASPRAP 790 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPPPXP 408 PP P P P PPPP PP P P P P P P P Sbjct: 761 PPPGPAPAAASPGPPPPASPPGAPASPRAPRTSPYGGLPAAPLAGPALP 809 >AF304164-1|AAG41947.1| 644|Homo sapiens keratin 1 protein. Length = 644 Score = 52.4 bits (120), Expect = 2e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GGG GG G GG G GGG GG G Sbjct: 93 GYGGGGFGGGGFGGGGFGGGGIGGGGFGG-FGSGGGGFGGGGFGGGG 138 Score = 52.0 bits (119), Expect = 3e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 G GGG GGGG G GGG GG G GG GG G GGG GG Sbjct: 98 GFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGG 141 Score = 48.4 bits (110), Expect = 3e-05 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GG G G G GG G GGG GG G Sbjct: 89 GFGGGY-GGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGG 133 Score = 47.2 bits (107), Expect = 8e-05 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG G GG GGGG G GGG GG G Sbjct: 103 GFGGGGFGGGGIGGGGF--GGFGSGGGGFGGGGFG-GGGYGGGYG 144 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXG--GGXRGGXG 543 G GGG G G G G GG GGG GG GG G G G GG GG G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRG 617 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GGGG GG GGGG G G GG G Sbjct: 85 GRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFG 130 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGGXG 543 G G G GGG G GGG GG G GG GG G GG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGG 128 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G GGGG G G GGGG G GG G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GG G G GGG GG G GGGG G GG G G G G Sbjct: 91 GGGYGGGGFGGGGFGGGGFGGGGI-GGGGFGGFGSGGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGG GG G GGGG GG G G Sbjct: 100 GGGGFGGGGFGGGGIGGGGFGGFGS--GGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G GG GG GG GG GG G GGG GG Sbjct: 567 GSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGG 611 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 +G G GG G GG G GGGGGG G GG G GGG G G Sbjct: 518 RGGGGGGYGSGGSSYGSGG-GSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGG 570 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGG G G GGGG G G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGG 137 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G GG G G G G GGG G G Sbjct: 533 GSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G G GG G GGGG G GG G G Sbjct: 560 GSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGG 607 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G G GGG G GGGG G G GG Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGG 556 Score = 40.7 bits (91), Expect = 0.007 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG G GGG G GGG GG G Sbjct: 514 GGGSRGGGG----GGYGSGGSSYGS--GGGSYGSGGGGGGGRG 550 Score = 40.7 bits (91), Expect = 0.007 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXG--XXGGGGGGXGGXXGGGGXG------XGGGXRGGXG 543 G GGG GG G G G GGG G GGGG G GG RGG G Sbjct: 540 GSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSG 592 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG--GGGXGGXXGGGGXXXXXXXGG 535 GGG G GG G G GGG GGG GG GGG GG Sbjct: 110 GGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGYGPVCPPGG 151 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGG G G GGG GG GG G GG G Sbjct: 589 GGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 39.1 bits (87), Expect = 0.021 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGGGGXG-----GXXGGGGXGXGGGXRGGXG 543 G GG G GGG G GGG G G G GG G GGG GG G Sbjct: 553 GSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRG 603 Score = 37.5 bits (83), Expect = 0.065 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G G GGGG GG GGG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGG 126 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GG G GGGG GG G G G G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGG-GGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXX--GGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 GG GGGG G G GGG G G GGGG G G G Sbjct: 515 GGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG 560 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG GGGG G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGG 596 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 440 GXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G RG GGG G G G GG GG G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRG 550 Score = 34.3 bits (75), Expect = 0.60 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +3 Query: 414 RGGXXXGXG------GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G G G G G GGGGG G G G GG G G G Sbjct: 518 RGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGG 574 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G G G G GG G GG G G G G Sbjct: 562 GGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSG 621 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G G G GG G GGG GG G Sbjct: 71 GGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGG 108 Score = 33.9 bits (74), Expect = 0.80 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG-GXGXXGG---GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGGG G GG G G GG G G G G Sbjct: 528 GGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSG 585 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G GG GGG GG G Sbjct: 535 GGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXG--GGGGGXGXXGGGGXG 512 GG G GG G G G GGGG G G GG G Sbjct: 105 GGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXG-XGGGXRGGXG 543 GG GG G G GG G G GG GG GG G GG + G Sbjct: 585 GGYRGGSGGGGGGSSGGRGSG-GGSSGGSIGGRGSSSGGVKSSGG 628 Score = 31.5 bits (68), Expect = 4.2 Identities = 23/95 (24%), Positives = 25/95 (26%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G G + G G + G G G G GG G Sbjct: 521 GGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGS 580 Query: 462 XGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GGGG G G G G Sbjct: 581 GSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGG 615 Score = 31.5 bits (68), Expect = 4.2 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 432 GXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G GG G G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG 600 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGG 536 RGG G GG G GGG G G G GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 +G G G G GG G GG G GG GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 >AF237621-1|AAF60327.1| 644|Homo sapiens keratin 1 protein. Length = 644 Score = 52.4 bits (120), Expect = 2e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GGG GG G GG G GGG GG G Sbjct: 93 GYGGGGFGGGGFGGGGFGGGGIGGGGFGG-FGSGGGGFGGGGFGGGG 138 Score = 52.0 bits (119), Expect = 3e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 G GGG GGGG G GGG GG G GG GG G GGG GG Sbjct: 98 GFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGG 141 Score = 48.4 bits (110), Expect = 3e-05 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGG GG G G G GG G GGG GG G Sbjct: 89 GFGGGY-GGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGG 133 Score = 47.2 bits (107), Expect = 8e-05 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG G GG GGGG G GGG GG G Sbjct: 103 GFGGGGFGGGGIGGGGF--GGFGSGGGGFGGGGFG-GGGYGGGYG 144 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXG--GGXRGGXG 543 G GGG G G G G GG GGG GG GG G G G GG GG G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRG 617 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG-XGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GGGG GG GGGG G G GG G Sbjct: 85 GRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFG 130 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGGXG 543 G G G GGG G GGG GG G GG GG G GG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGG 128 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G G G GGGG G G GGGG G GG G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 42.7 bits (96), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GG G G GGG GG G GGGG G GG G G G G Sbjct: 91 GGGYGGGGFGGGGFGGGGFGGGGI-GGGGFGGFGSGGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGG GG G GGGG GG G G Sbjct: 100 GGGGFGGGGFGGGGIGGGGFGGFGS--GGGGFGGGGFGGGGYGGG 142 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G GG GG GG GG GG G GGG GG Sbjct: 567 GSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGG 611 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 +G G GG G GG G GGGGGG G GG G GGG G G Sbjct: 518 RGGGGGGYGSGGSSYGSGG-GSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGG 570 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGG G G GGGG G G G G G G Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGG 137 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G GG G G G G GGG G G Sbjct: 533 GSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G G G GG G GGGG G GG G G Sbjct: 560 GSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGG 607 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G G GGG G GGGG G G GG Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGG 556 Score = 40.7 bits (91), Expect = 0.007 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG G GGG G GGG GG G Sbjct: 514 GGGSRGGGG----GGYGSGGSSYGS--GGGSYGSGGGGGGGRG 550 Score = 40.7 bits (91), Expect = 0.007 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXG--XXGGGGGGXGGXXGGGGXG------XGGGXRGGXG 543 G GGG GG G G G GGG G GGGG G GG RGG G Sbjct: 540 GSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSG 592 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG--GGGXGGXXGGGGXXXXXXXGG 535 GGG G GG G G GGG GGG GG GGG GG Sbjct: 110 GGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGYGPVCPPGG 151 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGG G G GGG GG GG G GG G Sbjct: 589 GGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 39.1 bits (87), Expect = 0.021 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGGGGGXG-----GXXGGGGXGXGGGXRGGXG 543 G GG G GGG G GGG G G G GG G GGG GG G Sbjct: 553 GSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRG 603 Score = 37.5 bits (83), Expect = 0.065 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G G GGGG GG GGG GG G Sbjct: 83 GGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGG 126 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GG G GGGG GG G G G G Sbjct: 569 GGGGGGHGSYGSGSSSGGYRGGSGG-GGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSG 627 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXX--GGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 GG GGGG G G GGG G G GGGG G G G Sbjct: 515 GGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG 560 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG GGGG G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGG 596 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 440 GXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G RG GGG G G G GG GG G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRG 550 Score = 34.3 bits (75), Expect = 0.60 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +3 Query: 414 RGGXXXGXG------GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G G G G G GGGGG G G G GG G G G Sbjct: 518 RGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGG 574 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G G G G GG G GG G G G G Sbjct: 562 GGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSG 621 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G G G GG G GGG GG G Sbjct: 71 GGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGG 108 Score = 33.9 bits (74), Expect = 0.80 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG-GXGXXGG---GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GGGGG G GG G G GG G G G G Sbjct: 528 GGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSG 585 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G G GG GGG GG G Sbjct: 535 GGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYG 579 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXG--GGGGGXGXXGGGGXG 512 GG G GG G G G GGGG G G GG G Sbjct: 105 GGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGG 138 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXG-XGGGXRGGXG 543 GG GG G G GG G G GG GG GG G GG + G Sbjct: 585 GGYRGGSGGGGGGSSGGRGSG-GGSSGGSIGGRGSSSGGVKSSGG 628 Score = 31.5 bits (68), Expect = 4.2 Identities = 23/95 (24%), Positives = 25/95 (26%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G G + G G + G G G G GG G Sbjct: 521 GGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGS 580 Query: 462 XGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GGGG G G G G Sbjct: 581 GSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGG 615 Score = 31.5 bits (68), Expect = 4.2 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 432 GXGGXGXGXXXGGG---GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G GG G G G G G G Sbjct: 543 GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG 600 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGG 536 RGG G GG G GGG G G G GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 +G G G G GG G GG G GG GG Sbjct: 588 RGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGG 628 >AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 2 protein. Length = 528 Score = 52.4 bits (120), Expect = 2e-06 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPP 417 P P P P PPPP PP PPPPPP P P PP PP Sbjct: 14 PGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 43.6 bits (98), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 512 PXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPPPP P PPPP P P P P Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP PPPPP PPPP PPP P Sbjct: 10 PGESPGATPAPGPP-PPPPPAPPQQQPPPPPPPAPPPGP 47 Score = 40.3 bits (90), Expect = 0.009 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPPP P P P P PP Sbjct: 10 PGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP PPPP P PPP P P PP PP Sbjct: 20 PGPPPPPPPAPPQQQPPPPP-PPAPPPGPGPAPPQHPPRAEALPP 63 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 52.4 bits (120), Expect = 2e-06 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PPL PPP P PPPP PP PPPP P Sbjct: 610 PSPPLPPPPPPPPPPPPPPPPPPPPLP 636 Score = 50.4 bits (115), Expect = 9e-06 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFF 381 P P + P P P PP PPPPPP P PPPP P P F Sbjct: 597 PQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMF 650 Score = 49.2 bits (112), Expect = 2e-05 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PP PPPPPP P PPPP PPP P Sbjct: 593 PPLSPQPKIVTPYTASQPSPPLPPPPPP--PPPPPPPPPPPPPPLP 636 Score = 46.0 bits (104), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P P PPPPPP P P PP P P Sbjct: 597 PQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 641 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P P PPPP P PPPPPP P P P Sbjct: 587 PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAP 641 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPPP P PPPPPP P P P+ Sbjct: 599 PKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPM 649 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P+ P P PPP PPPPP P PPPP P Sbjct: 896 PVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASP 934 Score = 40.3 bits (90), Expect = 0.009 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PP P PPP P PPPPPP Sbjct: 892 PSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPP 929 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P PP PPPP P PPPPPP P P P Sbjct: 903 PPPPPESSLVFPPPPPSPVPAPPPPPP-PTASPTPDKSGSP 942 Score = 36.7 bits (81), Expect = 0.11 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 7/79 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP----PPP---PPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 P PP PPP P P PP PP P P P P PP PP P + F Sbjct: 747 PTPP-PPPPIPAPLPPQAPPKPLVTIPAPTSTKTVAPVVTQAAPPTPTPPVPPAKKQPAF 805 Query: 383 FSXXXFXXXPXXXXXXPXP 327 + P P P Sbjct: 806 PASYIPPSPPTPPVPVPPP 824 Score = 36.3 bits (80), Expect = 0.15 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PP P PPPP P PP PP P P P Sbjct: 746 PPTPPPPPPIPAPLPPQAPP-KPLVTIPAP 774 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P P PPP PPP P P PPPP P P P Sbjct: 898 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSP 942 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPP P P P P P P PPPP Sbjct: 697 PPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPP 732 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP-XXPPP 415 P P PP PPP PPPPP P P PP P P P Sbjct: 898 PSPDFPP-------PPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 936 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXPXXXXKXP 387 P P P P P PPPPP PPP P PPP P P Sbjct: 882 PAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 936 Score = 34.7 bits (76), Expect = 0.46 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 P P PP PP P P P P PPP TP Sbjct: 898 PSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTP 936 Score = 33.9 bits (74), Expect = 0.80 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PP PP P P P+ P P P P Sbjct: 746 PPTPPPPPPIPAPLPPQAPPKPLVTIPAP 774 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P + PP PPP P PPPP P P P P Sbjct: 685 PQILVPPNGVVPPPPPP--PPPPTPGSAMAQLKPAPCAP 721 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 L PP PPPP PP P P P P P PP P Sbjct: 688 LVPPNGVVPPPPPPPPPPTPGSAMAQLKPAPCAPSLPQFSAPPPP 732 Score = 31.9 bits (69), Expect = 3.2 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP P P PPP P PPP P P Sbjct: 803 PAFPASYIPPSPPTPPVPVPPPTLPKQQSFCAKPPPSPLSPVP 845 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP P P P PP P P P Sbjct: 746 PPTPPPPPPIPAPLPP--QAPPKPLVTIPAP 774 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P P P PPP P P P P PPP P Sbjct: 916 PPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPPPTP 961 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage factor I 68 kDa subunit protein. Length = 551 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/57 (40%), Positives = 24/57 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXF 366 PP PPP PPPP P P PP P P PPP P P P P + F Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFF 362 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PPP PP PPPP P PP P PP Sbjct: 291 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 334 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP PPPP P P PP P PP Sbjct: 291 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 334 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PPPP P PPP P P PPPP PP P Sbjct: 287 PPLGPLP-PGPPPP-VPGYGPPPGPPPPQQGPPPPPGPFPPRP 327 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP P P PP P PP PPP Sbjct: 299 PVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPP 341 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP--PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP+ P P PP P P PPPP P PPPP PP P Sbjct: 273 PPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 319 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P P PP P P PP P PPP PPP P Sbjct: 310 PPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAP 355 Score = 44.0 bits (99), Expect = 7e-04 Identities = 26/95 (27%), Positives = 27/95 (28%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P PP P PP P PP PP P P P PP Sbjct: 218 PGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPV 277 Query: 385 FFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXP 281 FP F P P + PP P P Sbjct: 278 LFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPP 312 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXX 398 P P P PP P P PP PPPPP P P PP P PPL Sbjct: 283 PFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFP-PRPPGP-LGPPLTLAPP 340 Query: 397 XNXP 386 + P Sbjct: 341 PHLP 344 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPP-PPPPXX--XPXPXPPXPXXXPP 416 PP P PP P PP PPPP P P PP P PP Sbjct: 275 PPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPP 317 Score = 38.3 bits (85), Expect = 0.037 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPP 432 P PL PP PPP P PP PPP P PPP Sbjct: 327 PPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 365 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP--PP----XXPRXPXPPXPXXPPP 415 P PP PPP PP PP P PP P P PP P PPP Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPP-PGAPPP 353 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P P P P PP P P PP P P P P P N FFP Sbjct: 307 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAP-PPAPHVNPAFFP 363 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP------PPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P PP PP P P PP P PPP Sbjct: 208 PGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGP--PGPPGPPGPPP 254 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX----PPPPPPXXXPXPXPPXPXXXP 419 P P PP P PP P P PPP P P PP P P Sbjct: 307 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNP 359 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PPP P P PP PPP Sbjct: 274 PPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPP 318 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PP P PPP P PP P P Sbjct: 322 PFPPRPPGPLGPPLTLAPPPHLPGPPPGAP----PPAPHVNP 359 Score = 31.5 bits (68), Expect = 4.2 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXP-----RXPXPPXPXXPPP 415 P P PP PPP PP PPPP P + P P P PPP Sbjct: 247 PGPPGPPPPGQVL-PPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPP 298 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P P P P PPP P P PP Sbjct: 328 PGPLGPPLTLAPPPHLPGPP-PGAPPPAPHVNPAFFPP 364 >X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. Length = 551 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/57 (40%), Positives = 24/57 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXF 366 PP PPP PPPP P P PP P P PPP P P P P + F Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFF 362 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PPP PP PPPP P PP P PP Sbjct: 291 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 334 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP PPPP P P PP P PP Sbjct: 291 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 334 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PPPP P PPP P P PPPP PP P Sbjct: 287 PPLGPLP-PGPPPP-VPGYGPPPGPPPPQQGPPPPPGPFPPRP 327 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP P P PP P PP PPP Sbjct: 299 PVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPP 341 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP--PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP+ P P PP P P PPPP P PPPP PP P Sbjct: 273 PPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 319 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P P PP P P PP P PPP PPP P Sbjct: 310 PPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAP 355 Score = 44.0 bits (99), Expect = 7e-04 Identities = 26/95 (27%), Positives = 27/95 (28%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P PP P PP P PP PP P P P PP Sbjct: 218 PGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPV 277 Query: 385 FFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXP 281 FP F P P + PP P P Sbjct: 278 LFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPP 312 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXX 398 P P P PP P P PP PPPPP P P PP P PPL Sbjct: 283 PFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFP-PRPPGP-LGPPLTLAPP 340 Query: 397 XNXP 386 + P Sbjct: 341 PHLP 344 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPP-PPPPXX--XPXPXPPXPXXXPP 416 PP P PP P PP PPPP P P PP P PP Sbjct: 275 PPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPP 317 Score = 38.3 bits (85), Expect = 0.037 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPP 432 P PL PP PPP P PP PPP P PPP Sbjct: 327 PPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 365 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP--PP----XXPRXPXPPXPXXPPP 415 P PP PPP PP PP P PP P P PP P PPP Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPP-PGAPPP 353 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P P P P PP P P PP P P P P P N FFP Sbjct: 307 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAP-PPAPHVNPAFFP 363 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP------PPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P PP PP P P PP P PPP Sbjct: 208 PGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGP--PGPPGPPGPPP 254 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX----PPPPPPXXXPXPXPPXPXXXP 419 P P PP P PP P P PPP P P PP P P Sbjct: 307 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNP 359 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PPP P P PP PPP Sbjct: 274 PPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPP 318 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PP P PPP P PP P P Sbjct: 322 PFPPRPPGPLGPPLTLAPPPHLPGPPPGAP----PPAPHVNP 359 Score = 31.5 bits (68), Expect = 4.2 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXP-----RXPXPPXPXXPPP 415 P P PP PPP PP PPPP P + P P P PPP Sbjct: 247 PGPPGPPPPGQVL-PPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPP 298 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P P P P PPP P P PP Sbjct: 328 PGPLGPPLTLAPPPHLPGPP-PGAPPPAPHVNPAFFPP 364 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 563 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 604 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 574 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 631 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 556 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 592 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 556 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 615 Query: 429 --XXPPP 415 PPP Sbjct: 616 LGGVPPP 622 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 586 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 623 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 559 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 611 >BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. Length = 478 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/57 (40%), Positives = 24/57 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXF 366 PP PPP PPPP P P PP P P PPP P P P P + F Sbjct: 233 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFF 289 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PPP PP PPPP P PP P PP Sbjct: 218 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 261 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP PPPP P P PP P PP Sbjct: 218 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 261 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PPPP P PPP P P PPPP PP P Sbjct: 214 PPLGPLP-PGPPPPV-PGYGPPPGPPPPQQGPPPPPGPFPPRP 254 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP P P PP P PP PPP Sbjct: 226 PVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPP 268 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP--PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP+ P P PP P P PPPP P PPPP PP P Sbjct: 200 PPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 246 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P P PP P P PP P PPP PPP P Sbjct: 237 PPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAP 282 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXX 398 P P P PP P P PP PPPPP P P PP P PPL Sbjct: 210 PFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFP-PRPPGP-LGPPLTLAPP 267 Query: 397 XNXP 386 + P Sbjct: 268 PHLP 271 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPP-PPPPXX--XPXPXPPXPXXXPP 416 PP P PP P PP PPPP P P PP P PP Sbjct: 202 PPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPP 244 Score = 38.3 bits (85), Expect = 0.037 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPP 432 P PL PP PPP P PP PPP P PPP Sbjct: 254 PPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 292 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP--PP----XXPRXPXPPXPXXPPP 415 P PP PPP PP PP P PP P P PP P PPP Sbjct: 233 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPP-PGAPPP 280 Score = 36.3 bits (80), Expect = 0.15 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = -1 Query: 536 PPLXPPPX--PXPPPPXXPPXPP-PPPPXXPXXXXPPPP---XXPPPXPXXXXKXP 387 PPL PP PPPP P P PP P PPPP PPP P + P Sbjct: 188 PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGP 243 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P P P P PP P P PP P P P P P N FFP Sbjct: 234 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAP-PPAPHVNPAFFP 290 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX----PPPPPPXXXPXPXPPXPXXXP 419 P P PP P PP P P PPP P P PP P P Sbjct: 234 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNP 286 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PPP P P PP PPP Sbjct: 201 PPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPP 245 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP---XXPPP 415 P P PPP P P PP P P PP P PPP Sbjct: 189 PLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPP 234 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PP P PPP P PP P P Sbjct: 249 PFPPRPPGPLGPPLTLAPPPHLPGPPPGAP----PPAPHVNP 286 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P P P P PPP P P PP Sbjct: 255 PGPLGPPLTLAPPPHLPGPP-PGAPPPAPHVNPAFFPP 291 >BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. Length = 588 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/57 (40%), Positives = 24/57 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXF 366 PP PPP PPPP P P PP P P PPP P P P P + F Sbjct: 343 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFF 399 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PPP PP PPPP P PP P PP Sbjct: 328 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 371 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP PPPP P P PP P PP Sbjct: 328 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 371 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PPPP P PPP P P PPPP PP P Sbjct: 324 PPLGPLP-PGPPPP-VPGYGPPPGPPPPQQGPPPPPGPFPPRP 364 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP P P PP P PP PPP Sbjct: 336 PVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPP 378 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP--PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP+ P P PP P P PPPP P PPPP PP P Sbjct: 310 PPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 356 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P P PP P P PP P PPP PPP P Sbjct: 347 PPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAP 392 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP--XXXXPPPPXXPPPXP 408 P PPL PP P PP P P PPP P PPPP P P Sbjct: 274 PRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQP 320 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXX 398 P P P PP P P PP PPPPP P P PP P PPL Sbjct: 320 PFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFP-PRPPGP-LGPPLTLAPP 377 Query: 397 XNXP 386 + P Sbjct: 378 PHLP 381 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPP-PPPPXX--XPXPXPPXPXXXPP 416 PP P PP P PP PPPP P P PP P PP Sbjct: 312 PPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPP 354 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXPFXXXXSX 332 P PP P PP PP P P P PP FP F P Sbjct: 273 PPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPG 332 Query: 331 XPXXXXXFFXPPXPXXP 281 P + PP P P Sbjct: 333 PPPPVPGYGPPPGPPPP 349 Score = 38.3 bits (85), Expect = 0.037 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPP 432 P PL PP PPP P PP PPP P PPP Sbjct: 364 PPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 402 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP--PP----XXPRXPXPPXPXXPPP 415 P PP PPP PP PP P PP P P PP P PPP Sbjct: 343 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPP-PGAPPP 390 Score = 37.5 bits (83), Expect = 0.065 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPP--LXPPPXPXPPPPXXPPXPP---PPPPXXPXXXXPPPPXXPPPXP 408 P PP + PPP PP P PP P P P PP PPP P Sbjct: 289 PPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVP 338 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPP---XXPXXXXPPPPXXPPPXPXXXXKXPF 384 PP P PP P P PPPP P PP PP P PF Sbjct: 273 PPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPF 321 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P P P P PP P P PP P P P P P N FFP Sbjct: 344 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAP-PPAPHVNPAFFP 400 Score = 35.5 bits (78), Expect = 0.26 Identities = 30/102 (29%), Positives = 31/102 (30%), Gaps = 7/102 (6%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPP--PPPXXXPXPXPP-----XPXXXPPLXXXXXXN 392 P P P P PPPP PPP PP P PP P PPL Sbjct: 274 PRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGP 333 Query: 391 XPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXPXSXXL 266 P P + P P F PP P P L Sbjct: 334 PP--PVPGYGPPPGPPPPQQGPPPPPGPF-PPRPPGPLGPPL 372 Score = 34.7 bits (76), Expect = 0.46 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP---XXPPP 415 P P P PPP P P PP P P PP P PPP Sbjct: 297 PPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPP 344 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX----PPPPPPXXXPXPXPPXPXXXP 419 P P PP P PP P P PPP P P PP P P Sbjct: 344 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNP 396 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PPP P P PP PPP Sbjct: 311 PPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPP 355 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PP P PPP P PP P P Sbjct: 359 PFPPRPPGPLGPPLTLAPPPHLPGPPPGAP----PPAPHVNP 396 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P P P P PPP P P PP Sbjct: 365 PGPLGPPLTLAPPPHLPGPP-PGAPPPAPHVNPAFFPP 401 >AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL445209-3|CAI15184.1| 419|Homo sapiens POU domain, class 4, transcription factor 1 protein. Length = 419 Score = 52.0 bits (119), Expect = 3e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGGG G GG GGG GG GGGG G GGG GG Sbjct: 149 GGGGPGGGG----GPGGGPGGGGGGGPGGGGGGPGGGLLGG 185 Score = 51.2 bits (117), Expect = 5e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGGG G GG GGG G GGG GG G Sbjct: 133 GAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGG 175 Score = 50.4 bits (115), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GGG GG GGG G GGG GG Sbjct: 139 GGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGG 181 Score = 48.8 bits (111), Expect = 3e-05 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GG GGGG GG GGGG G GG GG G Sbjct: 133 GAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPG 179 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 GG G GG G G GGGGG GG GGGG GG Sbjct: 148 GGGGGPGGGGGPGGGPGGGGG-GGPGGGGGGPGGGLLGG 185 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G GGGG G GGGG G GG G G G G Sbjct: 130 GAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGG 176 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGG-----GGXGGXXGGGGXXXXXXXGGXXGXG 550 GG GG G GGGG GG GG GGGG GG G G Sbjct: 132 GGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGG 181 Score = 34.7 bits (76), Expect = 0.46 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G G G G GGGG GGG G GG G G G Sbjct: 130 GAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPG 179 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXG-XXGGGGXGXXXXXXGGXXG 545 GG G GG G GG GGG G GGG G GG G Sbjct: 141 GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLG 184 >AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP-PXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P + PPP P PP P P PPPPPP PPPP PPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP--PPP 597 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP--XXPPPXPXXXXKXPF 384 P PPL P P P PP P PPPPPP PPPP PP P P+ Sbjct: 567 PAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPGISLNLPY 624 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP P P PPPP P P PPP PPP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPP--PPPLP 585 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P P PP PPPP P PPPPPP P PP P Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPP 608 Query: 429 --XXPPP 415 PPP Sbjct: 609 LGGVPPP 615 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P PPPP PPPPP P PP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFPXXFFXLXP 353 P PP PPPPPP P P PPL P P F P Sbjct: 552 PAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPP 604 >AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenylation specific factor 6, 68 kD subunit variant protein. Length = 551 Score = 52.0 bits (119), Expect = 3e-06 Identities = 23/57 (40%), Positives = 24/57 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXF 366 PP PPP PPPP P P PP P P PPP P P P P + F Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFF 362 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PPP PP PPPP P PP P PP Sbjct: 291 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 334 Score = 49.2 bits (112), Expect = 2e-05 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP PPPP P P PP P PP Sbjct: 291 PLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 334 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPL P P P PPPP P PPP P P PPPP PP P Sbjct: 287 PPLGPLP-PGPPPP-VPGYGPPPGPPPPQQGPPPPPGPFPPRP 327 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P PPP P PP PP P P PP P PP PPP Sbjct: 299 PVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPP 341 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP--PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP+ P P PP P P PPPP P PPPP PP P Sbjct: 273 PPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPP 319 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P P PP P P PP P PPP PPP P Sbjct: 310 PPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAP 355 Score = 44.0 bits (99), Expect = 7e-04 Identities = 26/95 (27%), Positives = 27/95 (28%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXP 386 P P PP P PP P PP PP P P P PP Sbjct: 218 PGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPV 277 Query: 385 FFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXPXXP 281 FP F P P + PP P P Sbjct: 278 LFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPP 312 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXX 398 P P P PP P P PP PPPPP P P PP P PPL Sbjct: 283 PFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFP-PRPPGP-LGPPLTLAPP 340 Query: 397 XNXP 386 + P Sbjct: 341 PHLP 344 Score = 39.1 bits (87), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPP-PPPPXX--XPXPXPPXPXXXPP 416 PP P PP P PP PPPP P P PP P PP Sbjct: 275 PPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPP 317 Score = 38.3 bits (85), Expect = 0.037 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP--PXXPPXPPPPPPXXPXXXXPPP 432 P PL PP PPP P PP PPP P PPP Sbjct: 327 PPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPP 365 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPP--PP----XXPRXPXPPXPXXPPP 415 P PP PPP PP PP P PP P P PP P PPP Sbjct: 306 PPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPP-PGAPPP 353 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P P P P PP P P PP P P P P P N FFP Sbjct: 307 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAP-PPAPHVNPAFFP 363 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP------PPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P PP PP P P PP P PPP Sbjct: 208 PGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGP--PGPPGPPGPPP 254 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX----PPPPPPXXXPXPXPPXPXXXP 419 P P PP P PP P P PPP P P PP P P Sbjct: 307 PGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNP 359 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P P PPP P P PP PPP Sbjct: 274 PPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPP 318 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P P PP P PPP P PP P P Sbjct: 322 PFPPRPPGPLGPPLTLAPPPHLPGPPPGAP----PPAPHVNP 359 Score = 31.5 bits (68), Expect = 4.2 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP---XPPPPPPXXP-----RXPXPPXPXXPPP 415 P P PP PPP PP PPPP P + P P P PPP Sbjct: 247 PGPPGPPPPGQVL-PPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPP 298 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P P P P PPP P P PP Sbjct: 328 PGPLGPPLTLAPPPHLPGPP-PGAPPPAPHVNPAFFPP 364 >AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. Length = 1130 Score = 52.0 bits (119), Expect = 3e-06 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 8/51 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXP--------PXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P PPPP P P PPPPP P PP P PP P Sbjct: 17 PPPAPPPPPPPPPPSPPCSCSREECPSSPPPPPPPPLPGEPPIPPPPPGLP 67 Score = 45.6 bits (103), Expect = 2e-04 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 7/49 (14%) Frame = -1 Query: 542 PXPPLXPPPXPXPP-------PPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PP P PP PPPPP PPPP PP Sbjct: 21 PPPPPPPPP-PSPPCSCSREECPSSPPPPPPPPLPGEPPIPPPPPGLPP 68 Score = 37.9 bits (84), Expect = 0.049 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 507 PPPPXXPPXPPPPPP-XXPRXPXPPXPXXPPP 415 P PP PP PPP PP R P P PPP Sbjct: 19 PAPPPPPPPPPPSPPCSCSREECPSSPPPPPP 50 >U10063-1|AAA57161.1| 423|Homo sapiens POU domain factor protein. Length = 423 Score = 51.6 bits (118), Expect = 4e-06 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGG G GG GGG GG GGGG G GGG GG Sbjct: 149 GPGGGGGPGGGGGPGG--GGPGGGGGGGPGGGGGGPGGGLLGG 189 Score = 51.2 bits (117), Expect = 5e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGGG G GG GGGG G GGG G G Sbjct: 136 GAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGG 178 Score = 50.4 bits (115), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GGG G GGGG G GGG GG Sbjct: 142 GGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGGGPGG 184 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GG GGG G GG G G GGG GG G Sbjct: 136 GAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGG 180 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GGGG G GGGG G GGG GG Sbjct: 130 GAGGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGG 165 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG G G G G GG GGGG GGG GG G Sbjct: 130 GAGGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGG 172 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G G G G GG GG GGGG G GG GG G Sbjct: 132 GGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGG 173 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G GGGGG GG GGGG GG G G Sbjct: 142 GGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGGGPGGG 185 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGGXG 543 G GG G G G GGG G GG GG G GGG GG G Sbjct: 130 GAGGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPG 176 Score = 39.9 bits (89), Expect = 0.012 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG GG G GGGGG GG GGG GG G G Sbjct: 135 GGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGG 179 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GGG G GGGG G GG G G G G Sbjct: 132 GGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGGGPGGG 185 Score = 34.7 bits (76), Expect = 0.46 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G GG G G GGGG G G GGG G GG G Sbjct: 152 GGGGPGGGGGPGGGGPG-GGGGGGPGGGGGGPGGGLLG 188 Score = 34.3 bits (75), Expect = 0.60 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGG-GGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GG G GGGG GG G GGGG G GG G G G G Sbjct: 138 GAAAGGGGAHDGPG-GGGGPGGGGGPGGGGPG--GGGGGGPGGGGGGPGGGLLG 188 Score = 30.3 bits (65), Expect = 9.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 468 GGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG GG G GGG GG G G G G G Sbjct: 132 GGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGG 174 >L20433-1|AAA65605.1| 420|Homo sapiens octamer binding transcription factor 1 protein. Length = 420 Score = 51.6 bits (118), Expect = 4e-06 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGG G GG GGG GG GGGG G GGG GG Sbjct: 146 GPGGGGGPGGGGGPGG--GGPGGGGGGGPGGGGGGPGGGLLGG 186 Score = 51.2 bits (117), Expect = 5e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGGG G GG GGGG G GGG G G Sbjct: 133 GAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGG 175 Score = 50.4 bits (115), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GGG G GGGG G GGG GG Sbjct: 139 GGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGGGPGG 181 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GG GGG G GG G G GGG GG G Sbjct: 133 GAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGG 177 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G GGGGG GG GGGG GG G G Sbjct: 139 GGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGGGGPGGG 182 Score = 39.9 bits (89), Expect = 0.012 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG GG G GGGGG GG GGG GG G G Sbjct: 132 GGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGPGGGG 176 Score = 39.5 bits (88), Expect = 0.016 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GG G GGG GG G GGGG G GG G G G G Sbjct: 135 GAAAGGGGAHDGPGGGGGPGGGGGPGGGGPG--GGGGGGPGGGGGGPGGGLLG 185 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G G GGGG G GGGG G GG G G G G Sbjct: 130 GAGGAGAAAGGGGAHDGPGGGG-GPGGGGGPGGGGPGGGGGGGPGGGGGGPGGG 182 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 51.6 bits (118), Expect = 4e-06 Identities = 24/73 (32%), Positives = 26/73 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPP P PPPPPP P P PP P P Sbjct: 1962 PPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQ 2021 Query: 415 LXXXXXXNXPFFP 377 + + P FP Sbjct: 2022 VQLPVSLDLPLFP 2034 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 9/61 (14%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXX--------PPPPXXPPPXPXXXXKX 390 P P P P P PPPP PP PP P P PPP PPP P Sbjct: 1949 PISPSSPETPPPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPP 2008 Query: 389 P 387 P Sbjct: 2009 P 2009 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXP----PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PPP P PP P P P P P PP P PPP P P Sbjct: 1958 PPPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPP 2011 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P P PP PPPPPP P P PP P PPP Sbjct: 1959 PPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPP--PPPPPPPPPPP 2016 Score = 37.5 bits (83), Expect = 0.065 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPP----PXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P P PPP PP P P PP P PP Sbjct: 1961 PPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPP 2014 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 14/57 (24%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPP--------------PXXXPXPXPPXPXXXPP 416 P P P PPPP P PP P P P P PP P PP Sbjct: 1949 PISPSSPETPPPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPP 2005 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXPXP 327 P P P PPPPPP P PP P P K P P P P Sbjct: 1949 PISPSSPETPPPPPPPPPL-----PPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPP 2003 Score = 31.1 bits (67), Expect = 5.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P L P P PP PPPPPP P Sbjct: 3097 PALSLSSAPTKPLLQTPPPPPPPPPPPP 3124 Score = 30.3 bits (65), Expect = 9.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPP 483 P PL P P PPPP PP Sbjct: 3105 PTKPLLQTPPPPPPPPPPPP 3124 >AK025429-1|BAB15128.1| 274|Homo sapiens protein ( Homo sapiens cDNA: FLJ21776 fis, clone HEP00171. ). Length = 274 Score = 51.2 bits (117), Expect = 5e-06 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PP PP PPPP P PPP PPP P Sbjct: 227 PAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRP 272 Score = 50.4 bits (115), Expect = 9e-06 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P+ PP P P P PP P PP P PPPP PPP Sbjct: 217 PPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPP 259 Score = 47.2 bits (107), Expect = 8e-05 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P PP P PPPPP P P PP PP P Sbjct: 216 PPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPP 254 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P P PP PP P PP P PPP PPP Sbjct: 225 PPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPP 265 Score = 40.7 bits (91), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PP P P PPPP P PP P PPP Sbjct: 227 PAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPP-PSRPPP 270 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP--PPPXXXPXPXPPXP 431 P P P PP P P PP PPP PPP P P P P Sbjct: 220 PIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPP 270 Score = 37.9 bits (84), Expect = 0.049 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP--PPPPXXXPXPXPPXPXXXPP 416 P P P PPPP P PP PP P P P P PP Sbjct: 218 PAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPP 264 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXP--PPPPP-XXPRXPXPPXPXXPPP 415 PP PP P PP P P PP P PP P PPP Sbjct: 217 PPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPP 259 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXPXXXXKXP 387 PPP PPPP P P PPPP P PP P P Sbjct: 216 PPPAPIYTPPPPAPHCP----PPPPSAPTPPIPSPPSTLP 251 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPX--PPPPXXPXPPPPPPXXXPXPXP 440 P P P P P P PPPP P P PP P P P Sbjct: 225 PPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRP 272 Score = 32.7 bits (71), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P PP P PP PP R P P P P Sbjct: 232 PPPPPSAPTPPIPSPPSTLPPPPQAPPPN-RAPPPSRPPPRP 272 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P PP P PPP PP PP Sbjct: 226 PPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPP 269 >AF279145-1|AAK52094.1| 564|Homo sapiens tumor endothelial marker 8 precursor protein. Length = 564 Score = 51.2 bits (117), Expect = 5e-06 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PP PP PPPP P PPP PPP P Sbjct: 517 PAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRP 562 Score = 50.4 bits (115), Expect = 9e-06 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P+ PP P P P PP P PP P PPPP PPP Sbjct: 507 PPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPP 549 Score = 47.2 bits (107), Expect = 8e-05 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P PP P PPPPP P P PP PP P Sbjct: 506 PPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPP 544 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P P PP PP P PP P PPP PPP Sbjct: 515 PPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPP 555 Score = 40.7 bits (91), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PP P P PPPP P PP P PPP Sbjct: 517 PAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPP-PSRPPP 560 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP--PPPXXXPXPXPPXP 431 P P P PP P P PP PPP PPP P P P P Sbjct: 510 PIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPP 560 Score = 37.9 bits (84), Expect = 0.049 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP--PPPPXXXPXPXPPXPXXXPP 416 P P P PPPP P PP PP P P P P PP Sbjct: 508 PAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPP 554 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXP--PPPPP-XXPRXPXPPXPXXPPP 415 PP PP P PP P P PP P PP P PPP Sbjct: 507 PPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPP 549 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXPXXXXKXP 387 PPP PPPP P P PPPP P PP P P Sbjct: 506 PPPAPIYTPPPPAPHCP----PPPPSAPTPPIPSPPSTLP 541 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPX--PPPPXXPXPPPPPPXXXPXPXP 440 P P P P P P PPPP P P PP P P P Sbjct: 515 PPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRP 562 Score = 32.7 bits (71), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P PP P PP PP R P P P P Sbjct: 522 PPPPPSAPTPPIPSPPSTLPPPPQAPPPN-RAPPPSRPPPRP 562 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P PP P PPP PP PP Sbjct: 516 PPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPP 559 >AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activated, cyclic nucleotide-gated channel 2 protein. Length = 889 Score = 51.2 bits (117), Expect = 5e-06 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PPP P P PP P PPPPPP P P PP PP Sbjct: 18 PTTGPPPPPPPRPPKQQP-PPPPPPAPPPGPGPAPPQHPP 56 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P PPP PP PPP P P P PP Sbjct: 22 PPPPPPPRPPKQQPPPPPPPAPPPGPGPAPPQHPPRAEALPP 63 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP PPPPP PPPP PPP P Sbjct: 10 PGESPGASPTTGPP-PPPPPRPPKQQPPPPPPPAPPPGP 47 Score = 40.7 bits (91), Expect = 0.007 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP PPPP PP PPP P PP PP Sbjct: 23 PPPPPPRPPKQQPPPP--PPPAPPPGPGPAPPQHPPRAEALPP 63 Score = 40.3 bits (90), Expect = 0.009 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPPP P P P P PP Sbjct: 10 PGESPGASPTTGPPPPPPPRPPKQQPPPPPPPAPPPGPGPAPPQHPP 56 Score = 40.3 bits (90), Expect = 0.009 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 512 PXPPPPXXPPX-PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPPPP P PPPP P P P P Sbjct: 10 PGESPGASPTTGPPPPPPPRPPKQQPPPPPPPAPPPGPGPAPP 52 Score = 38.3 bits (85), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PPPP P PPPP P PP P PP Sbjct: 23 PPPPPPRPPKQQPPPPP--PPAPPPGPGPAPP 52 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPP 435 P L P P P P P PPPP PP P P Sbjct: 755 PRLVRRPPPGPAPAAASPGPPPPASPPGAPASPRAP 790 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPP---PPPXXPXXXXPPPPXXPPPXP 408 PP P P P PPPP PP P P P P P P P Sbjct: 761 PPPGPAPAAASPGPPPPASPPGAPASPRAPRTSPYGGLPAAPLAGPALP 809 >AC112230-1|AAX88860.1| 329|Homo sapiens unknown protein. Length = 329 Score = 51.2 bits (117), Expect = 5e-06 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX-PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPP P PP PP PPPP P PPP PPP P Sbjct: 282 PAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRP 327 Score = 50.4 bits (115), Expect = 9e-06 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P+ PP P P P PP P PP P PPPP PPP Sbjct: 272 PPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPP 314 Score = 47.2 bits (107), Expect = 8e-05 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P PP P PPPPP P P PP PP P Sbjct: 271 PPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPP 309 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P P PP PP P PP P PPP PPP Sbjct: 280 PPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPP 320 Score = 40.7 bits (91), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PP P P PPPP P PP P PPP Sbjct: 282 PAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPP-PSRPPP 325 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP--PPPXXXPXPXPPXP 431 P P P PP P P PP PPP PPP P P P P Sbjct: 275 PIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPP 325 Score = 37.9 bits (84), Expect = 0.049 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP--PPPPXXXPXPXPPXPXXXPP 416 P P P PPPP P PP PP P P P P PP Sbjct: 273 PAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPP 319 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXP--PPPPP-XXPRXPXPPXPXXPPP 415 PP PP P PP P P PP P PP P PPP Sbjct: 272 PPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPP 314 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXPXXXXKXP 387 PPP PPPP P P PPPP P PP P P Sbjct: 271 PPPAPIYTPPPPAPHCP----PPPPSAPTPPIPSPPSTLP 306 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPX--PPPPXXPXPPPPPPXXXPXPXP 440 P P P P P P PPPP P P PP P P P Sbjct: 280 PPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRP 327 Score = 32.7 bits (71), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P PP P PP PP R P P P P Sbjct: 287 PPPPPSAPTPPIPSPPSTLPPPPQAPPPN-RAPPPSRPPPRP 327 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P P PP P PPP PP PP Sbjct: 281 PPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPP 324 >Z29074-1|CAA82315.1| 623|Homo sapiens cytokeratin 9 protein. Length = 623 Score = 50.8 bits (116), Expect = 6e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G GG GG GG GGG G G G RGG G Sbjct: 476 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSG 517 Score = 50.4 bits (115), Expect = 9e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GGG G G GGG G GGG GG G Sbjct: 529 GSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYG 573 Score = 50.0 bits (114), Expect = 1e-05 Identities = 28/74 (37%), Positives = 29/74 (39%), Gaps = 2/74 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXX--GXXGGGGGGXGGXXGG 501 G G G + G G GGG GG G G GGG G GG GG Sbjct: 474 GLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGG 533 Query: 502 GGXGXGGGXRGGXG 543 G G GGG GG G Sbjct: 534 YGGGSGGGHSGGSG 547 Score = 50.0 bits (114), Expect = 1e-05 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GGG G GGG G G G RGG G Sbjct: 537 GSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSG 583 Score = 48.0 bits (109), Expect = 5e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G G G GGG GG GG G G GG GG Sbjct: 507 GGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGG 549 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG--XGXGGGXRGGXG 543 G GGG GG G G G GGG GG GG G G GG GG G Sbjct: 545 GSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSG 591 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GGG G GGG G GG GG Sbjct: 518 GSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGG 560 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GGG GG GG G G GGG GG G Sbjct: 87 GGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYG 128 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GG G G G G GG GG GG G G GG Sbjct: 110 GFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDGG 147 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 G GG GGG G GG GGG GG GG G G GG G G Sbjct: 514 GGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYG 559 Score = 43.6 bits (98), Expect = 0.001 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 409 GXGGGXXG-----GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG G GGG G G G GG G Sbjct: 89 GFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFG 138 Score = 43.2 bits (97), Expect = 0.001 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXG--GGXRGGXG 543 GG GGG G GG GGG GG GGG G G G GG GG G Sbjct: 98 GGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAG 142 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 +G G G G GG G G GGG GG GG GG G GG G G Sbjct: 513 RGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGG 566 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GGG G G GG GG GG Sbjct: 552 GGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGG 594 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG---GGGXGXGGGXRGGXG 543 G GG G G GG GGG GG G GG G GGG GG G Sbjct: 99 GASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDG 146 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG GG G G G GGG G GGG G GG G G G G G Sbjct: 521 GGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRG 580 Score = 40.7 bits (91), Expect = 0.007 Identities = 28/110 (25%), Positives = 29/110 (26%) Frame = +3 Query: 267 RXXXXGXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGX 446 R G G G G G G G + GG G GG Sbjct: 478 RGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGG 537 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG GGG GG G GG G G G G Sbjct: 538 SGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHG 587 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G G GG G G GGG G GG G GGG G GG G G Sbjct: 559 GGGSGSGGGSG----GGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 601 Score = 38.3 bits (85), Expect = 0.037 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-------GXGXGGGXRGGXG 543 GGG GG G GGG G GG GGG G G GGG GG G Sbjct: 74 GGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFG 124 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGG GG G G G GG G G G G Sbjct: 548 GGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEAS 607 Query: 594 G 596 G Sbjct: 608 G 608 Score = 37.9 bits (84), Expect = 0.049 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG---GGGGGXGGXXGG--GG----XGXGGGXRGGXG 543 G G G GGG G G GGG G GG GG GG G GGG GG G Sbjct: 565 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 618 Score = 37.5 bits (83), Expect = 0.065 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 10/53 (18%) Frame = +1 Query: 409 GXGGGXX-----GGGGXXXXGXXGGGGGG-----XGGXXGGGGXGXGGGXRGG 537 G GGG GGGG GG GGG GG GGG G GG GG Sbjct: 52 GYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGG 104 Score = 37.1 bits (82), Expect = 0.085 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GG G G GG G G G G G G G Sbjct: 91 GGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGG 144 Score = 37.1 bits (82), Expect = 0.085 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Frame = +2 Query: 416 GGGXXGX--GGXGXRGXXGG---GGGGXGGXXGG--GGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG G GG GG GG GG G G Sbjct: 565 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGG 616 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G GGG GG GGG G G GGG GG GG G Sbjct: 70 GYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFG 116 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GG GG GGGG G GG GG G Sbjct: 469 GAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSG--GGYGGGSG 511 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG-GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GG G G G GG GG GG G G G G Sbjct: 544 GGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGG 598 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGG-XXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GGG G GG GG GG G GG GG GG Sbjct: 561 GSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGES-GGSYGGG 603 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G GGGG G G G G G G Sbjct: 477 GRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 531 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG G GGG G GG G G G G Sbjct: 476 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYG 535 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G GGG G GGG G GG G G G G Sbjct: 99 GASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDGG 147 Score = 33.5 bits (73), Expect = 1.1 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGG G GGG G G G G G Sbjct: 540 GGHSGGSGGGHSGGSGGNYGGGSGS-GGGSGGGYGGGSGSRGGSGGSHGG 588 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGG--GXGXGGGXRGG 537 GG GGG GGG G GGG G GGG GG Sbjct: 39 GGRGGGGRFSSSSGYGGGSSRVCGRGGGGSFGYSYGGGSGGG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +3 Query: 321 KXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGG 500 K G G + G G GG G G G GGG G G G Sbjct: 472 KIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 531 Query: 501 GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G G Sbjct: 532 GGYG-GGSGGGHSGGSGGGHSGGSGG 556 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G GG G G G G GG GG Sbjct: 560 GGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGG 602 Score = 32.7 bits (71), Expect = 1.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G GGG G G GGG GG G G G Sbjct: 75 GGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYG 128 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG------GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GGG GG G G GGG G Sbjct: 62 GRGGG--GSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGG 110 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G GGG GGG G GG G G G G Sbjct: 65 GGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGG 113 Score = 31.5 bits (68), Expect = 4.2 Identities = 25/100 (25%), Positives = 27/100 (27%) Frame = +3 Query: 297 GGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGG 476 GG + G + G G G G G GG G GG Sbjct: 522 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGG 581 Query: 477 GGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G G Sbjct: 582 SGGSHGGGSGFG---GESGGSYGGGEEASGSGGGYGGGSG 618 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGG-GGGXGGXXGGGG 508 GG G G G G GGG G G GG G GG Sbjct: 109 GGFGGGFGGGSGGGFGGGYGSGFGGLGGFGG 139 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GG GG GGG G G G Sbjct: 573 GGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 618 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXX--GGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG GGGG G GG G G GG G G G G Sbjct: 52 GYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASG 102 >X75015-1|CAA52924.1| 622|Homo sapiens keratin 9 protein. Length = 622 Score = 50.8 bits (116), Expect = 6e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G GG GG GG GGG G G G RGG G Sbjct: 475 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSG 516 Score = 50.4 bits (115), Expect = 9e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GGG G G GGG G GGG GG G Sbjct: 528 GSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYG 572 Score = 50.0 bits (114), Expect = 1e-05 Identities = 28/74 (37%), Positives = 29/74 (39%), Gaps = 2/74 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXX--GXXGGGGGGXGGXXGG 501 G G G + G G GGG GG G G GGG G GG GG Sbjct: 473 GLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGG 532 Query: 502 GGXGXGGGXRGGXG 543 G G GGG GG G Sbjct: 533 YGGGSGGGHSGGSG 546 Score = 50.0 bits (114), Expect = 1e-05 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GGG G GGG G G G RGG G Sbjct: 536 GSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSG 582 Score = 48.0 bits (109), Expect = 5e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G G G GGG GG GG G G GG GG Sbjct: 506 GGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGG 548 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG--XGXGGGXRGGXG 543 G GGG GG G G G GGG GG GG G G GG GG G Sbjct: 544 GSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSG 590 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GGG G GGG G GG GG Sbjct: 517 GSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGG 559 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GGG GG GG G G GGG GG G Sbjct: 86 GGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYG 127 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GG G G G G GG GG GG G G GG Sbjct: 109 GFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDGG 146 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 G GG GGG G GG GGG GG GG G G GG G G Sbjct: 513 GGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYG 558 Score = 43.6 bits (98), Expect = 0.001 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 409 GXGGGXXG-----GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG G GGG G G G GG G Sbjct: 88 GFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFG 137 Score = 43.2 bits (97), Expect = 0.001 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXG--GGXRGGXG 543 GG GGG G GG GGG GG GGG G G G GG GG G Sbjct: 97 GGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAG 141 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 +G G G G GG G G GGG GG GG GG G GG G G Sbjct: 512 RGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGG 565 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GGG G G GG GG GG Sbjct: 551 GGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGG 593 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG---GGGXGXGGGXRGGXG 543 G GG G G GG GGG GG G GG G GGG GG G Sbjct: 98 GASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDG 145 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG GG G G G GGG G GGG G GG G G G G G Sbjct: 520 GGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRG 579 Score = 40.7 bits (91), Expect = 0.007 Identities = 28/110 (25%), Positives = 29/110 (26%) Frame = +3 Query: 267 RXXXXGXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGX 446 R G G G G G G G + GG G GG Sbjct: 477 RGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGG 536 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG GGG GG G GG G G G G Sbjct: 537 SGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHG 586 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G G GG G G GGG G GG G GGG G GG G G Sbjct: 558 GGGSGSGGGSG----GGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 600 Score = 38.3 bits (85), Expect = 0.037 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-------GXGXGGGXRGGXG 543 GGG GG G GGG G GG GGG G G GGG GG G Sbjct: 73 GGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFG 123 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGG GG G G G GG G G G G Sbjct: 547 GGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEAS 606 Query: 594 G 596 G Sbjct: 607 G 607 Score = 37.9 bits (84), Expect = 0.049 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG---GGGGGXGGXXGG--GG----XGXGGGXRGGXG 543 G G G GGG G G GGG G GG GG GG G GGG GG G Sbjct: 564 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 617 Score = 37.5 bits (83), Expect = 0.065 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 10/53 (18%) Frame = +1 Query: 409 GXGGGXX-----GGGGXXXXGXXGGGGGG-----XGGXXGGGGXGXGGGXRGG 537 G GGG GGGG GG GGG GG GGG G GG GG Sbjct: 51 GYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGG 103 Score = 37.1 bits (82), Expect = 0.085 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GG G G GG G G G G G G G Sbjct: 90 GGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGG 143 Score = 37.1 bits (82), Expect = 0.085 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Frame = +2 Query: 416 GGGXXGX--GGXGXRGXXGG---GGGGXGGXXGG--GGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG G GG GG GG GG G G Sbjct: 564 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGG 615 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G GGG GG GGG G G GGG GG GG G Sbjct: 69 GYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFG 115 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GG GG GGGG G GG GG G Sbjct: 468 GAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSG--GGYGGGSG 510 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG-GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GG G G G GG GG GG G G G G Sbjct: 543 GGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGG 597 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGG-XXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GGG G GG GG GG G GG GG GG Sbjct: 560 GSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGES-GGSYGGG 602 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G GGGG G G G G G G Sbjct: 476 GRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 530 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG G GGG G GG G G G G Sbjct: 475 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYG 534 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G GGG G GGG G GG G G G G Sbjct: 98 GASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDGG 146 Score = 33.5 bits (73), Expect = 1.1 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGG G GGG G G G G G Sbjct: 539 GGHSGGSGGGHSGGSGGNYGGGSGS-GGGSGGGYGGGSGSRGGSGGSHGG 587 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGG--GXGXGGGXRGG 537 GG GGG GGG G GGG G GGG GG Sbjct: 38 GGRGGGGRFSSSSGYGGGSSRVCGRGGGGSFGYSYGGGSGGG 79 Score = 33.1 bits (72), Expect = 1.4 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +3 Query: 321 KXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGG 500 K G G + G G GG G G G GGG G G G Sbjct: 471 KIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 530 Query: 501 GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G G Sbjct: 531 GGYG-GGSGGGHSGGSGGGHSGGSGG 555 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G GG G G G G GG GG Sbjct: 559 GGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGG 601 Score = 32.7 bits (71), Expect = 1.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G GGG G G GGG GG G G G Sbjct: 74 GGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYG 127 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG------GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GGG GG G G GGG G Sbjct: 61 GRGGG--GSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGG 109 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G GGG GGG G GG G G G G Sbjct: 64 GGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGG 112 Score = 31.5 bits (68), Expect = 4.2 Identities = 25/100 (25%), Positives = 27/100 (27%) Frame = +3 Query: 297 GGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGG 476 GG + G + G G G G G GG G GG Sbjct: 521 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGG 580 Query: 477 GGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G G Sbjct: 581 SGGSHGGGSGFG---GESGGSYGGGEEASGSGGGYGGGSG 617 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGG-GGGXGGXXGGGG 508 GG G G G G GGG G G GG G GG Sbjct: 108 GGFGGGFGGGSGGGFGGGYGSGFGGLGGFGG 138 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GG GG GGG G G G Sbjct: 572 GGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 617 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXX--GGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG GGGG G GG G G GG G G G G Sbjct: 51 GYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASG 101 >X56597-1|CAA39935.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 21 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 19 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 63 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 9 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 53 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +G G G G GG G G GGG G GGG G GGG GG G Sbjct: 2 KPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 60 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 31 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 27 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 79 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 21 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 68 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 26 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 83 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 47 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 83 >S69510-1|AAC60619.1| 622|Homo sapiens cytokeratin 9 protein. Length = 622 Score = 50.8 bits (116), Expect = 6e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G GG GG GG GGG G G G RGG G Sbjct: 475 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSG 516 Score = 50.4 bits (115), Expect = 9e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GGG G G GGG G GGG GG G Sbjct: 528 GSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYG 572 Score = 50.0 bits (114), Expect = 1e-05 Identities = 28/74 (37%), Positives = 29/74 (39%), Gaps = 2/74 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXX--GXXGGGGGGXGGXXGG 501 G G G + G G GGG GG G G GGG G GG GG Sbjct: 473 GLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGG 532 Query: 502 GGXGXGGGXRGGXG 543 G G GGG GG G Sbjct: 533 YGGGSGGGHSGGSG 546 Score = 50.0 bits (114), Expect = 1e-05 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GGG G GGG G G G RGG G Sbjct: 536 GSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSG 582 Score = 48.0 bits (109), Expect = 5e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G G G GGG GG GG G G GG GG Sbjct: 506 GGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGG 548 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG--XGXGGGXRGGXG 543 G GGG GG G G G GGG GG GG G G GG GG G Sbjct: 544 GSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSG 590 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GGG G GGG G GG GG Sbjct: 517 GSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGG 559 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GGG GG GG G G GGG GG G Sbjct: 86 GGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYG 127 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GG G G G G GG GG GG G G GG Sbjct: 109 GFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDGG 146 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 G GG GGG G GG GGG GG GG G G GG G G Sbjct: 513 GGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYG 558 Score = 43.6 bits (98), Expect = 0.001 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 409 GXGGGXXG-----GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG G GGG G G G GG G Sbjct: 88 GFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFG 137 Score = 43.2 bits (97), Expect = 0.001 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXG--GGXRGGXG 543 GG GGG G GG GGG GG GGG G G G GG GG G Sbjct: 97 GGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAG 141 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 +G G G G GG G G GGG GG GG GG G GG G G Sbjct: 512 RGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGG 565 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GGG G G GG GG GG Sbjct: 551 GGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGG 593 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG---GGGXGXGGGXRGGXG 543 G GG G G GG GGG GG G GG G GGG GG G Sbjct: 98 GASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDG 145 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG GG G G G GGG G GGG G GG G G G G G Sbjct: 520 GGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRG 579 Score = 40.7 bits (91), Expect = 0.007 Identities = 28/110 (25%), Positives = 29/110 (26%) Frame = +3 Query: 267 RXXXXGXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGX 446 R G G G G G G G + GG G GG Sbjct: 477 RGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGG 536 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG GGG GG G GG G G G G Sbjct: 537 SGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHG 586 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G G GG G G GGG G GG G GGG G GG G G Sbjct: 558 GGGSGSGGGSG----GGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 600 Score = 38.3 bits (85), Expect = 0.037 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-------GXGXGGGXRGGXG 543 GGG GG G GGG G GG GGG G G GGG GG G Sbjct: 73 GGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFG 123 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGG GG G G G GG G G G G Sbjct: 547 GGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEAS 606 Query: 594 G 596 G Sbjct: 607 G 607 Score = 37.9 bits (84), Expect = 0.049 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG---GGGGGXGGXXGG--GG----XGXGGGXRGGXG 543 G G G GGG G G GGG G GG GG GG G GGG GG G Sbjct: 564 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 617 Score = 37.5 bits (83), Expect = 0.065 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 10/53 (18%) Frame = +1 Query: 409 GXGGGXX-----GGGGXXXXGXXGGGGGG-----XGGXXGGGGXGXGGGXRGG 537 G GGG GGGG GG GGG GG GGG G GG GG Sbjct: 51 GYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGG 103 Score = 37.1 bits (82), Expect = 0.085 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G GG G GG G G GG G G G G G G G Sbjct: 90 GGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGG 143 Score = 37.1 bits (82), Expect = 0.085 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Frame = +2 Query: 416 GGGXXGX--GGXGXRGXXGG---GGGGXGGXXGG--GGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG G GG GG GG GG G G Sbjct: 564 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGG 615 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G GGG GG GGG G G GGG GG GG G Sbjct: 69 GYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFG 115 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GG GG GGGG G GG GG G Sbjct: 468 GAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSG--GGYGGGSG 510 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG-GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GG G G G GG GG GG G G G G Sbjct: 543 GGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGG 597 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGG-XXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GGG G GG GG GG G GG GG GG Sbjct: 560 GSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGES-GGSYGGG 602 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G GGGG G G G G G G Sbjct: 476 GRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 530 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG G GGG G GG G G G G Sbjct: 475 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYG 534 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G GGG G GGG G GG G G G G Sbjct: 98 GASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGLGGFGGGAGGGDGG 146 Score = 33.5 bits (73), Expect = 1.1 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGG G GGG G G G G G Sbjct: 539 GGHSGGSGGGHSGGSGGNYGGGSGS-GGGSGGGYGGGSGSRGGSGGSHGG 587 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGG--GXGXGGGXRGG 537 GG GGG GGG G GGG G GGG GG Sbjct: 38 GGRGGGGRFSSSSGYGGGSSRVCGRGGGGSFGYSYGGGSGGG 79 Score = 33.1 bits (72), Expect = 1.4 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +3 Query: 321 KXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGG 500 K G G + G G GG G G G GGG G G G Sbjct: 471 KIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 530 Query: 501 GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G G Sbjct: 531 GGYG-GGSGGGHSGGSGGGHSGGSGG 555 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G GG G G G G GG GG Sbjct: 559 GGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGG 601 Score = 32.7 bits (71), Expect = 1.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G GGG G G GGG GG G G G Sbjct: 74 GGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYG 127 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG------GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GGG GG G G GGG G Sbjct: 61 GRGGG--GSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGG 109 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G G GGG GGG G GG G G G G Sbjct: 64 GGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGG 112 Score = 31.5 bits (68), Expect = 4.2 Identities = 25/100 (25%), Positives = 27/100 (27%) Frame = +3 Query: 297 GGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGG 476 GG + G + G G G G G GG G GG Sbjct: 521 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGG 580 Query: 477 GGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G G Sbjct: 581 SGGSHGGGSGFG---GESGGSYGGGEEASGSGGGYGGGSG 617 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGG-GGGXGGXXGGGG 508 GG G G G G GGG G G GG G GG Sbjct: 108 GGFGGGFGGGSGGGFGGGYGSGFGGLGGFGG 138 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GG GG GGG G G G Sbjct: 572 GGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 617 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXX--GGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG GGGG G GG G G GG G G G G Sbjct: 51 GYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASG 101 >M59849-1|AAA52453.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 21 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 19 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 63 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 9 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 53 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +G G G G GG G G GGG G GGG G GGG GG G Sbjct: 2 KPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 60 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 31 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 27 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 79 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 21 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 68 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 26 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 83 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 47 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 83 >CR457069-1|CAG33350.1| 321|Homo sapiens FBL protein. Length = 321 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 21 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 19 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 63 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 9 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 53 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +G G G G GG G G GGG G GGG G GGG GG G Sbjct: 2 KPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 60 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 31 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 27 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 79 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 21 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 68 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 26 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 83 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 47 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 83 >BT020144-1|AAV38946.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 21 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 19 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 63 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 9 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 53 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +G G G G GG G G GGG G GGG G GGG GG G Sbjct: 2 KPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 60 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 31 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 27 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 79 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 21 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 68 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 26 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 83 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 47 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 83 >BT006830-1|AAP35476.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 21 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 19 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 63 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 9 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 53 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +G G G G GG G G GGG G GGG G GGG GG G Sbjct: 2 KPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 60 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 31 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 27 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 79 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 21 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 68 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 26 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 83 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 47 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 83 >BC121170-1|AAI21171.1| 467|Homo sapiens KRT9 protein protein. Length = 467 Score = 50.8 bits (116), Expect = 6e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G GG GG GG GGG G G G RGG G Sbjct: 320 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSG 361 Score = 50.4 bits (115), Expect = 9e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GGG G G GGG G GGG GG G Sbjct: 373 GSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYG 417 Score = 50.0 bits (114), Expect = 1e-05 Identities = 28/74 (37%), Positives = 29/74 (39%), Gaps = 2/74 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXX--GXXGGGGGGXGGXXGG 501 G G G + G G GGG GG G G GGG G GG GG Sbjct: 318 GLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGG 377 Query: 502 GGXGXGGGXRGGXG 543 G G GGG GG G Sbjct: 378 YGGGSGGGHSGGSG 391 Score = 50.0 bits (114), Expect = 1e-05 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GGG G GGG G G G RGG G Sbjct: 381 GSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSG 427 Score = 48.0 bits (109), Expect = 5e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G G G GGG GG GG G G GG GG Sbjct: 351 GGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGG 393 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG--XGXGGGXRGGXG 543 G GGG GG G G G GGG GG GG G G GG GG G Sbjct: 389 GSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSG 435 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG GGG G GGG G GG GG Sbjct: 362 GSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGG 404 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGG-XXGGGGXGXGGGXRGGXG 543 G GG GGG G GG GGG GG GG G G GG G G Sbjct: 358 GGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYG 403 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 +G G G G GG G G GGG GG GG GG G GG G G Sbjct: 357 RGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGG 410 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GGG G G GG GG GG Sbjct: 396 GGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGG 438 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG GG G G G GGG G GGG G GG G G G G G Sbjct: 365 GGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRG 424 Score = 40.7 bits (91), Expect = 0.007 Identities = 28/110 (25%), Positives = 29/110 (26%) Frame = +3 Query: 267 RXXXXGXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGX 446 R G G G G G G G + GG G GG Sbjct: 322 RGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGG 381 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG GGG GG G GG G G G G Sbjct: 382 SGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHG 431 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGGXG 543 G G G GG G G GGG G GG G GGG G GG G G Sbjct: 403 GGGSGSGGGSG----GGYGGGSGSRGGSGGSHGGGSGFGGESGGSYG 445 Score = 37.9 bits (84), Expect = 0.049 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGX-GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G GG G G GGG GG G G G GG G G G G Sbjct: 392 GGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEAS 451 Query: 594 G 596 G Sbjct: 452 G 452 Score = 37.9 bits (84), Expect = 0.049 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG---GGGGGXGGXXGG--GG----XGXGGGXRGGXG 543 G G G GGG G G GGG G GG GG GG G GGG GG G Sbjct: 409 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 462 Score = 37.1 bits (82), Expect = 0.085 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Frame = +2 Query: 416 GGGXXGX--GGXGXRGXXGG---GGGGXGGXXGG--GGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG G GG GG GG GG G G Sbjct: 409 GGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGG 460 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G G GG GG GGGG G GG GG G Sbjct: 313 GAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSG--GGYGGGSG 355 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG-GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G GG G G G GG GG GG G G G G Sbjct: 388 GGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGG 442 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGG-XXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GGG G GG GG GG G GG GG GG Sbjct: 405 GSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGES-GGSYGGG 447 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G GGGG G G G G G G Sbjct: 321 GRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 375 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG G GGG G GG G G G G Sbjct: 320 GGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYG 379 Score = 33.5 bits (73), Expect = 1.1 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GGG G GGG G G G G G Sbjct: 384 GGHSGGSGGGHSGGSGGNYGGGSGS-GGGSGGGYGGGSGSRGGSGGSHGG 432 Score = 33.1 bits (72), Expect = 1.4 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +3 Query: 321 KXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGG 500 K G G + G G GG G G G GGG G G G Sbjct: 316 KIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSG 375 Query: 501 GGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G G Sbjct: 376 GGYG-GGSGGGHSGGSGGGHSGGSGG 400 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G GG G GG G G G G GG GG Sbjct: 404 GGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGG 446 Score = 31.5 bits (68), Expect = 4.2 Identities = 25/100 (25%), Positives = 27/100 (27%) Frame = +3 Query: 297 GGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGG 476 GG + G + G G G G G GG G GG Sbjct: 366 GGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGG 425 Query: 477 GGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG G G G G G Sbjct: 426 SGGSHGGGSGFG---GESGGSYGGGEEASGSGGGYGGGSG 462 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GG GG GGG G G G Sbjct: 417 GGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSG 462 >BC019260-1|AAH19260.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 21 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 19 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 63 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 9 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 53 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +G G G G GG G G GGG G GGG G GGG GG G Sbjct: 2 KPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 60 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 31 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 27 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 79 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 21 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 68 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 26 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 83 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 47 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 83 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP PPP P PPPP P PPPP PPP P Sbjct: 485 PHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGP 529 Score = 50.0 bits (114), Expect = 1e-05 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP-XXPXXXXPPPPXXP--PPXPXXXXKXP 387 P PPP P PPPP PPPPPP PPPP P PP P P Sbjct: 442 PGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPP 494 Score = 46.8 bits (106), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP---PPXXPXXXXPPPPXXPPPXP 408 PPP P PP P PPPP P PPPP PPP P Sbjct: 492 PPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPP 533 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXP 408 P PPL P PPPP PP PPPPP P PPP P Sbjct: 507 PPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPPPLSDTTKP 553 Score = 43.6 bits (98), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-----PXXPPP 414 P PPL PP P P PPPPPP PPP P PPP Sbjct: 430 PAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPP 477 Score = 42.3 bits (95), Expect = 0.002 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 13/54 (24%) Frame = -1 Query: 536 PPLXPPPXPX----PPPPXXPPX--PPPPPPXXPXXXXPPP-------PXXPPP 414 PPL PPP PPPP P PPPPP P PPP P PPP Sbjct: 493 PPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPPP 546 Score = 41.9 bits (94), Expect = 0.003 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 10/82 (12%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXX--PPXPPPPP-----PXXPXXXXPPPPXXPPPXPXXXXK 393 P PP PPP P PPPP P PPPP P P PPP PP Sbjct: 448 PAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLP 507 Query: 392 XPFFSXXXFXXXPXXXXXXPXP 327 P S P P P Sbjct: 508 PPPLSQPTRGAPPPPPPPPPGP 529 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP PPPP P PP P P P PP P P Sbjct: 446 PPPAPPPPPPPMIGIPPPP-PPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYP 504 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP--PPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P PP P PPPP P PPPP P P PPL + P P Sbjct: 448 PAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLP 507 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX----PPPPPPXXXPXPXPPXP 431 P P P PP PPPP PPPPPP P P PP P Sbjct: 487 PDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPP---PPPGPPPP 532 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PPPP PPPPPP P P P P Sbjct: 428 PPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSP 481 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXP 419 P P P P P P PPPP P PPPP P P P P Sbjct: 466 PIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPP 525 Query: 418 P 416 P Sbjct: 526 P 526 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P PP P PP PPPPPP P PP P Sbjct: 429 PPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPP 466 Score = 37.1 bits (82), Expect = 0.085 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 9/60 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---------PXXPPPXPXXXXKXPF 384 PP P P P P P P PPPP PPP P PPP P PF Sbjct: 476 PPPSSPSFP-PHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPF 534 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP PP PPP PP P P PPP Sbjct: 504 PTLPPPPLSQPTRGAPPP--PPPPPPGPPPPPFTGADGQPAVPPP 546 Score = 36.3 bits (80), Expect = 0.15 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFX 363 P PP P PP P PPP PP P PP PP P S F Sbjct: 425 PSHPPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFP 484 Query: 362 XXPXXXXXXPXP 327 P P P Sbjct: 485 PHPDFAAPPPLP 496 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX--PPXPPPP---PPXXPRXPXPPXPXXPPP 415 P P PPPP P PPPP P P PP P PPP Sbjct: 484 PPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPP 531 Score = 35.5 bits (78), Expect = 0.26 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 10/53 (18%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX---PPXPPPPPPXXPRXPXPP-------XPXXPPP 415 P PP PP P PP PPPP P P PP P PPP Sbjct: 472 PGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPP 524 Score = 34.7 bits (76), Expect = 0.46 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 9/64 (14%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPP----PPPP-----XXPRXPXPPXPXXPPPXXXXXX 397 P PP PPP PP PP PPPP P P PP PP Sbjct: 432 PPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAA 491 Query: 396 XTPL 385 PL Sbjct: 492 PPPL 495 Score = 33.9 bits (74), Expect = 0.80 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 10/53 (18%) Frame = -3 Query: 543 PXXPPXXXXXXXPP---PPXXPPX--PPPPPPXXPRXPXPP-----XPXXPPP 415 P PP PP P PP PPPPPP P PP P PPP Sbjct: 425 PSHPPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPP 477 Score = 33.5 bits (73), Expect = 1.1 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P PP PPPP PP PPPP P P P Sbjct: 432 PPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPP--PPIGFGSPGTPPPPSSPSFPPHPDF 489 Query: 429 XXPPP 415 PPP Sbjct: 490 AAPPP 494 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP PP P PPP PP P PP Sbjct: 487 PDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPPP 546 Query: 415 L 413 L Sbjct: 547 L 547 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P P P P PPPP PP P P Sbjct: 456 PMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQP 514 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 50.8 bits (116), Expect = 6e-06 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP PPP P PPPP P PPPP PPP P Sbjct: 356 PHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGP 400 Score = 50.0 bits (114), Expect = 1e-05 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP-XXPXXXXPPPPXXP--PPXPXXXXKXP 387 P PPP P PPPP PPPPPP PPPP P PP P P Sbjct: 313 PGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPP 365 Score = 46.8 bits (106), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP---PPXXPXXXXPPPPXXPPPXP 408 PPP P PP P PPPP P PPPP PPP P Sbjct: 363 PPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPP 404 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXP--PPPXXPPPXP 408 P PPL P PPPP PP PPPPP P PPP P Sbjct: 378 PPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPPPLSDTTKP 424 Score = 43.6 bits (98), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP-----PXXPPP 414 P PPL PP P P PPPPPP PPP P PPP Sbjct: 301 PAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPP 348 Score = 42.3 bits (95), Expect = 0.002 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 13/54 (24%) Frame = -1 Query: 536 PPLXPPPXPX----PPPPXXPPX--PPPPPPXXPXXXXPPP-------PXXPPP 414 PPL PPP PPPP P PPPPP P PPP P PPP Sbjct: 364 PPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPPP 417 Score = 41.9 bits (94), Expect = 0.003 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 10/82 (12%) Frame = -1 Query: 542 PXPPLXPPPX---PXPPPPXX--PPXPPPPP-----PXXPXXXXPPPPXXPPPXPXXXXK 393 P PP PPP P PPPP P PPPP P P PPP PP Sbjct: 319 PAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLP 378 Query: 392 XPFFSXXXFXXXPXXXXXXPXP 327 P S P P P Sbjct: 379 PPPLSQPTRGAPPPPPPPPPGP 400 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PP PPPP P PP P P P PP P P Sbjct: 317 PPPAPPPPPPPMIGIPPPP-PPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYP 375 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPP--PPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P PP P PPPP P PPPP P P PPL + P P Sbjct: 319 PAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLP 378 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPX----PPPPPPXXXPXPXPPXP 431 P P P PP PPPP PPPPPP P P PP P Sbjct: 358 PDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPP---PPPGPPPP 403 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXPXXXP 419 P P P P P PPPP PPPPPP P P P P Sbjct: 299 PPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSP 352 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXP 419 P P P P P P PPPP P PPPP P P P P Sbjct: 337 PIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPP 396 Query: 418 P 416 P Sbjct: 397 P 397 Score = 37.5 bits (83), Expect = 0.065 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P PP P PP PPPPPP P PP P Sbjct: 300 PPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPP 337 Score = 37.1 bits (82), Expect = 0.085 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 9/60 (15%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---------PXXPPPXPXXXXKXPF 384 PP P P P P P P PPPP PPP P PPP P PF Sbjct: 347 PPPSSPSFP-PHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPF 405 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPP PP PPP PP P P PPP Sbjct: 375 PTLPPPPLSQPTRGAPPP--PPPPPPGPPPPPFTGADGQPAVPPP 417 Score = 36.3 bits (80), Expect = 0.15 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFX 363 P PP P PP P PPP PP P PP PP P S F Sbjct: 296 PSHPPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFP 355 Query: 362 XXPXXXXXXPXP 327 P P P Sbjct: 356 PHPDFAAPPPLP 367 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX--PPXPPPP---PPXXPRXPXPPXPXXPPP 415 P P PPPP P PPPP P P PP P PPP Sbjct: 355 PPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPP 402 Score = 35.5 bits (78), Expect = 0.26 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 10/53 (18%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX---PPXPPPPPPXXPRXPXPP-------XPXXPPP 415 P PP PP P PP PPPP P P PP P PPP Sbjct: 343 PGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPP 395 Score = 34.7 bits (76), Expect = 0.46 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 9/64 (14%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPP----PPPP-----XXPRXPXPPXPXXPPPXXXXXX 397 P PP PPP PP PP PPPP P P PP PP Sbjct: 303 PPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAA 362 Query: 396 XTPL 385 PL Sbjct: 363 PPPL 366 Score = 33.9 bits (74), Expect = 0.80 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 10/53 (18%) Frame = -3 Query: 543 PXXPPXXXXXXXPP---PPXXPPX--PPPPPPXXPRXPXPP-----XPXXPPP 415 P PP PP P PP PPPPPP P PP P PPP Sbjct: 296 PSHPPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPP 348 Score = 33.5 bits (73), Expect = 1.1 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXP 430 P P P PP PPPP PP PPPP P P P Sbjct: 303 PPLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPP--PPIGFGSPGTPPPPSSPSFPPHPDF 360 Query: 429 XXPPP 415 PPP Sbjct: 361 AAPPP 365 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP PP P PPP PP P PP Sbjct: 358 PDFAAPPPLPPPPAADYPTLPPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPPP 417 Query: 415 L 413 L Sbjct: 418 L 418 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P P P P PPPP PP P P Sbjct: 327 PMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQP 385 >AC006950-1|AAD15623.1| 227|Homo sapiens FBRL_HUMAN [AA 1- 227] protein. Length = 227 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 21 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 19 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 63 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 9 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 53 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 367 KXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 K +G G G G GG G G GGG G GGG G GGG GG G Sbjct: 2 KPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 60 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 31 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 73 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 27 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 79 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 21 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 68 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 26 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 83 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 47 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 83 >AC005393-3|AAC28913.1| 318|Homo sapiens FBRL_HUMAN protein. Length = 318 Score = 50.8 bits (116), Expect = 6e-06 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGGGGG GG G GG G G G G Sbjct: 18 RGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 70 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGG G G GGGG G GGG RGG G Sbjct: 16 GDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGG 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G RG GG GG GG GGG GG G G Sbjct: 6 GGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGG 50 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G GG G RG GGGGG GG GGG GG G G Sbjct: 28 GGGRGRGG-GFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRG 70 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGG-GXXGG-GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG G G GGG G GGG G GGG GG G Sbjct: 11 GRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG 57 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXG-GGXRG 534 +G G GGG G G G GGGGG G GG GG G G GG RG Sbjct: 24 RGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRG 76 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G GGG G GG G G G GGG GG G Sbjct: 10 GGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGG 54 Score = 35.1 bits (77), Expect = 0.34 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G G GGG G GGG G GG G G G Sbjct: 18 RGGRG-GRGGFGGGR--GRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGG 65 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G G G +G G GGG GGGG G G G GG G G Sbjct: 23 GRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GGGG GG G G G G G Sbjct: 44 GGGGGGGGGG-----GGRGGGGFHSGGNRGRGRGGKRGNQSG 80 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -1 Query: 536 PPLXP-PPXPXPP-PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + P PP PP PP PP PPPPPP PPP PPP Sbjct: 564 PTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPP 606 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL P P PP PP PPPPP PPPP PP P Sbjct: 568 PLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPPMDP 609 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PP PP PPPPPP P P PPP Sbjct: 564 PTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPP 606 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 32.7 bits (71), Expect = 1.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPP PPPPPP P P PP+ Sbjct: 568 PLPPGVQPPLPPGAPPP----PPPPPPGSAGMMYAPPPPPPPPM 607 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect(2) = 0.028 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP PPPPP PP P PP Sbjct: 568 PLPPGVQPPLPPGAPPPP-----PPPPPGSAGMMYAPPPPPPPP 606 Score = 27.1 bits (57), Expect(2) = 0.028 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P + PPP P P P PPP Sbjct: 421 PPPWMQPPPPPMNQGPHPPGHHGPPP 446 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -1 Query: 536 PPLXP-PPXPXPP-PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + P PP PP PP PP PPPPPP PPP PPP Sbjct: 564 PTMVPLPPGVQPPLPPGAPPPPPPPPPVSAGMMYAPPPPPPPP 606 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL P P PP PP PPPPP PPPP PP P Sbjct: 568 PLPPGVQPPLPPGAPPPPPPPPPVSAGMMYAPPPPPPPPMDP 609 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PP PP PPPPPP P P PPP Sbjct: 564 PTMVPLPPGVQPPLPPGAPPPPPPPPPVSAGMMYAPPPPPPPP 606 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 32.7 bits (71), Expect = 1.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPP PPPPPP P P PP+ Sbjct: 568 PLPPGVQPPLPPGAPPP----PPPPPPVSAGMMYAPPPPPPPPM 607 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect(2) = 0.028 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP PPPPP PP P PP Sbjct: 568 PLPPGVQPPLPPGAPPPP-----PPPPPVSAGMMYAPPPPPPPP 606 Score = 27.1 bits (57), Expect(2) = 0.028 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P + PPP P P P PPP Sbjct: 421 PPPWMQPPPPPMNQGPHPPGHHGPPP 446 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 50.4 bits (115), Expect = 9e-06 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PPP P PPPP PP PP PPP P PP P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 L PP P PPPP PP PPP PP P PP P Sbjct: 175 LTQPPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPP P PPPP PP PPPPPP P P Sbjct: 179 PPPPPPPPPLPPPP--PPQPPPPPPQSLGPPGRPNP 212 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 178 PPPPPPPPPPLPP---PPPPQPPPPPP 201 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PPPP P PPPPPP P P PP P Sbjct: 172 PSYLTQPPPPPPPPPPLPPPPPP--QPPPPPPQSLGPP 207 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP---PPXXP 453 P PP PPP P PPPP PP PPP PP P Sbjct: 179 PPPPPPPPPLPPPPPPQ-PPPPPPQSLGPPGRP 210 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPPP PP PP PPP P PPP PP Sbjct: 178 PPPPPPPP-PPLPPPPPPQPPPPPPQSLGPP 207 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P PPPPPP P P PP P PPP Sbjct: 160 PPVQSSLNMHSVPSYLTQPPPPPPPPPPLPPPPPPQPPPP 199 Score = 39.1 bits (87), Expect = 0.021 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 PP P PP PP PPPPPP P P P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 37.1 bits (82), Expect = 0.085 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP 439 P PP PPPP PP PPP P P P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPPPP P P PP P PP Sbjct: 154 PMPQGPPPVQSSLNMHSVPSYLTQPPPPP-PPPPPLPPPPPPQPP 197 Score = 33.9 bits (74), Expect = 0.80 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 533 PLXPPPXPXP----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PPPPPP PPPP PPP P P Sbjct: 156 PQGPPPVQSSLNMHSVPSYLTQPPPPPP-------PPPPLPPPPPPQPPPPPP 201 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 50.4 bits (115), Expect = 9e-06 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PPP P PPPP PP PP PPP P PP P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 L PP P PPPP PP PPP PP P PP P Sbjct: 175 LTQPPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPP P PPPP PP PPPPPP P P Sbjct: 179 PPPPPPPPPLPPPP--PPQPPPPPPQSLGPPGRPNP 212 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 178 PPPPPPPPPPLPP---PPPPQPPPPPP 201 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PPPP P PPPPPP P P PP P Sbjct: 172 PSYLTQPPPPPPPPPPLPPPPPP--QPPPPPPQSLGPP 207 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP---PPXXP 453 P PP PPP P PPPP PP PPP PP P Sbjct: 179 PPPPPPPPPLPPPPPPQ-PPPPPPQSLGPPGRP 210 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPPP PP PP PPP P PPP PP Sbjct: 178 PPPPPPPP-PPLPPPPPPQPPPPPPQSLGPP 207 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P PPPPPP P P PP P PPP Sbjct: 160 PPVQSSLNMHSVPSYLTQPPPPPPPPPPLPPPPPPQPPPP 199 Score = 39.1 bits (87), Expect = 0.021 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 PP P PP PP PPPPPP P P P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 37.1 bits (82), Expect = 0.085 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP 439 P PP PPPP PP PPP P P P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPPPP P P PP P PP Sbjct: 154 PMPQGPPPVQSSLNMHSVPSYLTQPPPPP-PPPPPLPPPPPPQPP 197 Score = 33.9 bits (74), Expect = 0.80 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 533 PLXPPPXPXP----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PPPPPP PPPP PPP P P Sbjct: 156 PQGPPPVQSSLNMHSVPSYLTQPPPPPP-------PPPPLPPPPPPQPPPPPP 201 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 50.4 bits (115), Expect = 9e-06 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PPP P PPPP PP PP PPP P PP P Sbjct: 119 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 153 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 L PP P PPPP PP PPP PP P PP P Sbjct: 116 LTQPPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 153 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPP P PPPP PP PPPPPP P P Sbjct: 120 PPPPPPPPPLPPPP--PPQPPPPPPQSLGPPGRPNP 153 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 119 PPPPPPPPPPLPP---PPPPQPPPPPP 142 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PPPP P PPPPPP P P PP P Sbjct: 113 PSYLTQPPPPPPPPPPLPPPPPP--QPPPPPPQSLGPP 148 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP---PPXXP 453 P PP PPP P PPPP PP PPP PP P Sbjct: 120 PPPPPPPPPLPPPPPPQ-PPPPPPQSLGPPGRP 151 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPPP PP PP PPP P PPP PP Sbjct: 119 PPPPPPPP-PPLPPPPPPQPPPPPPQSLGPP 148 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P PPPPPP P P PP P PPP Sbjct: 101 PPVQSSLNMHSVPSYLTQPPPPPPPPPPLPPPPPPQPPPP 140 Score = 39.1 bits (87), Expect = 0.021 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 PP P PP PP PPPPPP P P P Sbjct: 119 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 153 Score = 37.1 bits (82), Expect = 0.085 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP 439 P PP PPPP PP PPP P P P Sbjct: 119 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPPPP P P PP P PP Sbjct: 95 PMPQGPPPVQSSLNMHSVPSYLTQPPPPP-PPPPPLPPPPPPQPP 138 Score = 33.9 bits (74), Expect = 0.80 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 533 PLXPPPXPXP----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PPPPPP PPPP PPP P P Sbjct: 97 PQGPPPVQSSLNMHSVPSYLTQPPPPPP-------PPPPLPPPPPPQPPPPPP 142 >BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger protein 162 protein. Length = 265 Score = 50.4 bits (115), Expect = 9e-06 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -1 Query: 536 PPLXP-PPXPXPP-PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P + P PP PP PP PP PPPPPP PPP PPP Sbjct: 190 PTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPP 232 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 97 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 139 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL P P PP PP PPPPP PPPP PP P Sbjct: 194 PLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPPMDP 235 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 97 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 137 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PP PP PPPPPP P P PPP Sbjct: 190 PTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPP 232 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 99 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 149 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 43 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 82 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 105 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 150 Score = 32.7 bits (71), Expect = 1.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPP PPPPPP P P PP+ Sbjct: 194 PLPPGVQPPLPPGAPPP----PPPPPPGSAGMMYAPPPPPPPPM 233 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 43 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 73 Score = 30.7 bits (66), Expect(2) = 0.029 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 97 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 126 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 98 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 136 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP PPPPP PP P PP Sbjct: 194 PLPPGVQPPLPPGAPPPP-----PPPPPGSAGMMYAPPPPPPPP 232 Score = 27.1 bits (57), Expect(2) = 0.029 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P + PPP P P P PPP Sbjct: 47 PPPWMQPPPPPMNQGPHPPGHHGPPP 72 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 50.4 bits (115), Expect = 9e-06 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PPP P PPPP PP PP PPP P PP P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 L PP P PPPP PP PPP PP P PP P Sbjct: 175 LTQPPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 47.2 bits (107), Expect = 8e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP PPP P PPPP PP PPPPPP P P Sbjct: 179 PPPPPPPPPLPPPP--PPQPPPPPPQSLGPPGRPNP 212 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 178 PPPPPPPPPPLPP---PPPPQPPPPPP 201 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P PPPP P PPPPPP P P PP P Sbjct: 172 PSYLTQPPPPPPPPPPLPPPPPP--QPPPPPPQSLGPP 207 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPP---PPXXP 453 P PP PPP P PPPP PP PPP PP P Sbjct: 179 PPPPPPPPPLPPPPPPQ-PPPPPPQSLGPPGRP 210 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPPP PP PP PPP P PPP PP Sbjct: 178 PPPPPPPP-PPLPPPPPPQPPPPPPQSLGPP 207 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P PPPPPP P P PP P PPP Sbjct: 160 PPVQSSLNMHSVPSYLTQPPPPPPPPPPLPPPPPPQPPPP 199 Score = 39.1 bits (87), Expect = 0.021 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 PP P PP PP PPPPPP P P P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 37.1 bits (82), Expect = 0.085 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXP 439 P PP PPPP PP PPP P P P Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPPPP P P PP P PP Sbjct: 154 PMPQGPPPVQSSLNMHSVPSYLTQPPPPP-PPPPPLPPPPPPQPP 197 Score = 33.9 bits (74), Expect = 0.80 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -1 Query: 533 PLXPPPXPXP----PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P PPPPPP PPPP PPP P P Sbjct: 156 PQGPPPVQSSLNMHSVPSYLTQPPPPPP-------PPPPLPPPPPPQPPPPPP 201 >X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for calcium dependent protease (small subunit). ). Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-activated neutral protease small subunit gene, exon 11. ). Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. Length = 322 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing 4 protein. Length = 1362 Score = 50.0 bits (114), Expect = 1e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P PP P PPPPPP P P PPP Sbjct: 757 PPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPP 799 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PPP PP PPPPP PPPP PP P Sbjct: 750 PAPVPQQPPP--PPQQPPPPPPPQQQQQPPPPPPPPSMP 786 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP---PXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP P PPPPPP P+ P PPP Sbjct: 752 PVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPP 799 Score = 40.7 bits (91), Expect = 0.007 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPP----PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPP P P PP PP P P P PPP P + P Sbjct: 758 PPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLP 813 Score = 39.9 bits (89), Expect = 0.012 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFF 381 P P P PPP PP PPP P PPP P P F Sbjct: 750 PAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPF 800 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX--PPPPXXPPPXP 408 P PL P PP PP PPPP P PPPP P P P Sbjct: 940 PPTPLLPSVKVQSQPP--PPLPPPPHPSVQQQLQQQPPPPPPPQPQP 984 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX------PPPPXXPPPXPXXXXKXP 387 PP PPP P PPP PP P P PPP PP P + P Sbjct: 974 PPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPP 1029 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPL PP P P PPPPP P PPP P Sbjct: 954 PPPPL--PPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRP 996 Score = 36.3 bits (80), Expect = 0.15 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP P PP PP P PPP P PP Sbjct: 243 PPQPLQTPPPVPPQPQPPPAPAPQPVQSHPP 273 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPPP P P PPP PP P P+ Sbjct: 954 PPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPP--QQQHQPPPRPVHLQPM 1002 Score = 33.9 bits (74), Expect = 0.80 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PP P + P PP P PP Sbjct: 941 PTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPP 985 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P PL PP P PP P PP P P P Sbjct: 243 PPQPLQTPP-PVPPQPQPPPAPAPQP 267 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P P PPP P PPP P P PP Sbjct: 244 PQPLQTPPPVPPQPQPPPAPAPQPVQSHPP 273 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPP 437 PPPP PP PPP P P P Sbjct: 1011 PPPPQGQQPPHPPPGQQPPPPQP 1033 Score = 32.3 bits (70), Expect = 2.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 506 PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P P P PP P P P P PP Sbjct: 243 PPQPLQTPPPVPPQPQPPPAPAPQPVQSHPP 273 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PPP P P P P P P P P P Sbjct: 244 PQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQP 281 Score = 31.9 bits (69), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP-PXPXXPP 418 PP P P P PP P P P P P PP Sbjct: 243 PPQPLQTPPPVPPQPQPPPAPAPQPVQSHPP 273 Score = 31.1 bits (67), Expect = 5.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXP 430 PPPP P PPP P P P P Sbjct: 1011 PPPPQGQQPPHPPPGQQPPPPQPAKP 1036 Score = 31.1 bits (67), Expect = 5.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPP 462 PPP PP PP PPPP Sbjct: 1011 PPPPQGQQPPHPPPGQQPPPP 1031 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P P PP P PPPP P P P P Sbjct: 754 PQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPP 799 Score = 30.3 bits (65), Expect = 9.8 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P P P PP PP PPP P P+ P P Sbjct: 940 PPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPP 994 Score = 30.3 bits (65), Expect = 9.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP P P PPP PP P P P Sbjct: 1011 PPPPQGQQP-PHPPPGQQPPPPQPAKP 1036 >AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent protease, small (regulatory) subunit (calpain) (calcium-activ protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. Length = 268 Score = 50.0 bits (114), Expect = 1e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG G G G GGG GG GGGG G GGG Sbjct: 16 GGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGG 54 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG G GG GGGG G GGG GG G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 47.2 bits (107), Expect = 8e-05 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 409 GXGGGXXGGG-----GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 G GGG GGG G G GGGGGG GG GGGG G G R Sbjct: 15 GGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR 60 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG GGGG G GGG GG G Sbjct: 10 GGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 Score = 46.0 bits (104), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGGG G GG G GGGG G GGG GG G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGG 53 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G GGGGGG GG GGGG G GG Sbjct: 20 GLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGG 64 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 +GG G GG G G G GG G GGGG G GG G G Sbjct: 9 KGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGG 56 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GGGGGG G GGG G G G G G G Sbjct: 12 GGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGG 55 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GGGGGG G G G GG G G G G Sbjct: 11 GGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGG 52 >DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. Length = 1262 Score = 49.6 bits (113), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PPL PPPP P PPPPPP PPPP P P PF Sbjct: 667 PPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGP 726 Query: 371 XFXXXPXXXXXXPXPXF 321 P P P F Sbjct: 727 GIPPPPPGMGMPPPPPF 743 Score = 46.8 bits (106), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFSX 375 P PPL P P PP P P PPPPP P P PPP PP P P Sbjct: 693 PPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPV 752 Query: 374 XXFXXXP 354 F P Sbjct: 753 LPFGLTP 759 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP---PPPPXXPXXXXPPPPXXPPPXP 408 PP P P PP P P PPPP PPPP PPP P Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPP 609 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPPP P PPP PPP P P Sbjct: 654 PSPSSLPGSTAIPPPPPLPGSARIPPPPPPLPGSAGIPPP--PPPLPGEAGMPP 705 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPP----XPXXPPP 415 P P P PPPP P P PPPP P P P PP P PPP Sbjct: 678 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPP 731 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP PP P PPPPP P P P P P P F Sbjct: 666 PPPPPLPGSARIPPPP--PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPF 722 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX----PPXPPPPP-PXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P P PP PP Sbjct: 692 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPP 739 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PP P PPPPP P P PP P Sbjct: 575 PAPPLPGDSGTIIPPPPAPGDSTTPPPPPP--PPPPPPLP 612 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -1 Query: 530 LXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 + PPP P PPP PP PPPPPP PP P Sbjct: 587 IPPPPAPGDSTTPPP--PPPPPPPPPLPGGVCISSPPSLP 624 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P P PPPPP P PP P Sbjct: 705 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVP 748 Score = 37.1 bits (82), Expect = 0.085 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 11/50 (22%) Frame = -1 Query: 536 PPLXPPPXPXPPPP-----XXPPXPP------PPPPXXPXXXXPPPPXXP 420 PP PPP P PP P PP P PPPP PPPP P Sbjct: 599 PPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 648 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = -1 Query: 542 PXPPLXPPPX------PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP P P P PP P PPPPPP PPPP P Sbjct: 572 PVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPP------PPPPPPLP 612 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPPP PP P Sbjct: 668 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 720 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PPPP P P PPP P P P PPP P F Sbjct: 691 PPPPPPLPGEAGMPPPPPPLPGGPGIPPP--PPFPGGPGIPPPPPGMGMPPPPPFGF 745 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-----PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P PP P P Sbjct: 656 PSSLPGSTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGP 714 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPPP P P P P Sbjct: 680 PPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 723 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXP---XPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPP P P PP P PP Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPP 609 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP PPPP PPPPP P P Sbjct: 705 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 751 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PPPPP P P P P P Sbjct: 654 PSPSSLPGSTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 698 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP-PXXXPXPXPP 437 P P P PP PPP P PPPPP P PP Sbjct: 568 PSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPLPGGVCISSPP 621 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP----PXPP--------PPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPPP P P PPPP P PPP PPP P Sbjct: 631 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGSTAIPPPPPLPGSARIPPP--PPPLP 685 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPP-PXXPRXPXPPXP 430 P PP P P P PPPPP P R P PP P Sbjct: 642 PPPPPLPEGVGIPSPSSLPGSTAIPPPPPLPGSARIPPPPPP 683 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PPPP PP P PPP Sbjct: 565 PSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPP 607 Score = 31.1 bits (67), Expect = 5.6 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 15/60 (25%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-------PPPPPXXPXXXXPPP--------PXXPPPXP 408 P PPP P PPPP PP P PP P PPP P PPP P Sbjct: 593 PGDSTTPPPPPPPPPP--PPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPP--PPPLP 648 >DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. Length = 229 Score = 49.6 bits (113), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PPL PPPP P PPPPPP PPPP P P PF Sbjct: 61 PPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGP 120 Query: 371 XFXXXPXXXXXXPXPXF 321 P P P F Sbjct: 121 GIPPPPPGMGMPPPPPF 137 Score = 46.8 bits (106), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFSX 375 P PPL P P PP P P PPPPP P P PPP PP P P Sbjct: 87 PPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPV 146 Query: 374 XXFXXXP 354 F P Sbjct: 147 LPFGLTP 153 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPPP P PPP PPP P P Sbjct: 48 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPP--PPPLPGEAGMPP 99 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPP----XPXXPPP 415 P P P PPPP P P PPPP P P P PP P PPP Sbjct: 72 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPP 125 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP PP P PPPPP P P P P P P F Sbjct: 60 PPPPPLPGSARIPPPP--PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPF 116 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX----PPXPPPPP-PXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P P PP PP Sbjct: 86 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPP 133 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P P PPPPP P PP P Sbjct: 99 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVP 142 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPPP PP P Sbjct: 62 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 114 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PPPP P P PPP P P P PPP P F Sbjct: 85 PPPPPPLPGEAGMPPPPPPLPGGPGIPPP--PPFPGGPGIPPPPPGMGMPPPPPFGF 139 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-----PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P PP P P Sbjct: 50 PSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGP 108 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPPP P P P P Sbjct: 74 PPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 117 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP PPPP PPPPP P P Sbjct: 99 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 145 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PPPPP P P P P P Sbjct: 48 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 92 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP----PXPP--------PPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPPP P P PPPP P PPP PPP P Sbjct: 25 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPP--PPPLP 79 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPP-PXXPRXPXPPXP 430 P PP P P P PPPPP P R P PP P Sbjct: 36 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPP 77 >BC122558-1|AAI22559.1| 578|Homo sapiens keratin 77 protein. Length = 578 Score = 49.6 bits (113), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GGG G GGGG GG R G G Sbjct: 514 GSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 558 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGX----GGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GG GGG GG GG G G G G GG G Sbjct: 499 GAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGG 547 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GG GGG GG G G GG GG G Sbjct: 498 GGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYG 539 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G G G GGG GG G Sbjct: 510 GYGGGSGGGYGGGRSYRGGGARGGSGGGYGSG-CGGGGGSYGGSG 553 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G + RGG G G G G GGGGG G G G G Sbjct: 514 GSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 558 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG G G GG G GG GG G G GG G Sbjct: 85 GGGVGGFGGGRGFGVGSTGAGGFG-GGGFGGAGFGTSNFGLGGFG 128 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GG GGG GGG G G G G G Sbjct: 502 GGGSYGSGGYGGGSG-GGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYG 550 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GG G G G G GG GG GG G G R Sbjct: 527 GGGARGGSG----GGYGSGCGGGGGSYGGSGRSGRGSSR 561 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G G GG GGG G G G G GGG GG G Sbjct: 81 GFCQGGGVGGFGGGRGFGVGSTGAGGFGGGGFGGAG 116 Score = 31.5 bits (68), Expect = 4.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGG-GGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G R GGG GG GG G G GG G Sbjct: 512 GGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSG 556 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G GGG G G GGG G G G Sbjct: 499 GAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCG 543 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G GGG G GGG G G G G Sbjct: 509 GGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 558 >BC118598-1|AAI18599.1| 345|Homo sapiens KRT1B protein protein. Length = 345 Score = 49.6 bits (113), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GGG G GGGG GG R G G Sbjct: 281 GSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 325 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGX----GGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GG GGG GG GG G G G G GG G Sbjct: 266 GAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGG 314 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GG GGG GG G G GG GG G Sbjct: 265 GGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYG 306 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G G G GGG GG G Sbjct: 277 GYGGGSGGGYGGGRSYRGGGARGGSGGGYGSG-CGGGGGSYGGSG 320 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G + RGG G G G G GGGGG G G G G Sbjct: 281 GSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 325 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GG GGG GGG G G G G G Sbjct: 269 GGGSYGSGGYG-GGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYG 317 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GG G G G G GG GG GG G G R Sbjct: 294 GGGARGGSG----GGYGSGCGGGGGSYGGSGRSGRGSSR 328 Score = 31.5 bits (68), Expect = 4.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGG-GGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G R GGG GG GG G G GG G Sbjct: 279 GGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSG 323 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G GGG G G GGG G G G Sbjct: 266 GAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCG 310 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G GGG G GGG G G G G Sbjct: 276 GGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 325 >BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (Drosophila) protein. Length = 1262 Score = 49.6 bits (113), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PPL PPPP P PPPPPP PPPP P P PF Sbjct: 667 PPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGP 726 Query: 371 XFXXXPXXXXXXPXPXF 321 P P P F Sbjct: 727 GIPPPPPGMGMPPPPPF 743 Score = 46.8 bits (106), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFSX 375 P PPL P P PP P P PPPPP P P PPP PP P P Sbjct: 693 PPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPV 752 Query: 374 XXFXXXP 354 F P Sbjct: 753 LPFGLTP 759 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPP---PPPPXXPXXXXPPPPXXPPPXP 408 PP P P PP P P PPPP PPPP PPP P Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPP 609 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPPP P PPP PPP P P Sbjct: 654 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPP--PPPLPGEAGMPP 705 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPP----XPXXPPP 415 P P P PPPP P P PPPP P P P PP P PPP Sbjct: 678 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPP 731 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP PP P PPPPP P P P P P P F Sbjct: 666 PPPPPLPGSARIPPPP--PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPF 722 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX----PPXPPPPP-PXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P P PP PP Sbjct: 692 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPP 739 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PP P PPPPP P P PP P Sbjct: 575 PAPPLPGDSGTIIPPPPAPGDSTTPPPPPP--PPPPPPLP 612 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -1 Query: 530 LXPPPXPXP---PPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 + PPP P PPP PP PPPPPP PP P Sbjct: 587 IPPPPAPGDSTTPPP--PPPPPPPPPLPGGVCISSPPSLP 624 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P P PPPPP P PP P Sbjct: 705 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVP 748 Score = 37.1 bits (82), Expect = 0.085 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 11/50 (22%) Frame = -1 Query: 536 PPLXPPPXPXPPPP-----XXPPXPP------PPPPXXPXXXXPPPPXXP 420 PP PPP P PP P PP P PPPP PPPP P Sbjct: 599 PPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 648 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = -1 Query: 542 PXPPLXPPPX------PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP P P P PP P PPPPPP PPPP P Sbjct: 572 PVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPP------PPPPPPLP 612 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPPP PP P Sbjct: 668 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 720 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PPPP P P PPP P P P PPP P F Sbjct: 691 PPPPPPLPGEAGMPPPPPPLPGGPGIPPP--PPFPGGPGIPPPPPGMGMPPPPPFGF 745 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-----PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P PP P P Sbjct: 656 PSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGP 714 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPPP P P P P Sbjct: 680 PPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 723 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXP---XPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPP P P PP P PP Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPP 609 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP PPPP PPPPP P P Sbjct: 705 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 751 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PPPPP P P P P P Sbjct: 654 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 698 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP-PXXXPXPXPP 437 P P P PP PPP P PPPPP P PP Sbjct: 568 PSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPLPGGVCISSPP 621 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP----PXPP--------PPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPPP P P PPPP P PPP PPP P Sbjct: 631 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPP--PPPLP 685 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPP-PXXPRXPXPPXP 430 P PP P P P PPPPP P R P PP P Sbjct: 642 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPP 683 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PPPP PP P PPP Sbjct: 565 PSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPP 607 Score = 31.1 bits (67), Expect = 5.6 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 15/60 (25%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-------PPPPPXXPXXXXPPP--------PXXPPPXP 408 P PPP P PPPP PP P PP P PPP P PPP P Sbjct: 593 PGDSTTPPPPPPPPPP--PPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPP--PPPLP 648 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 49.6 bits (113), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PPL PPPP P PPPPPP PPPP P P PF Sbjct: 677 PPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGP 736 Query: 371 XFXXXPXXXXXXPXPXF 321 P P P F Sbjct: 737 GIPPPPPGMGMPPPPPF 753 Score = 46.8 bits (106), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFSX 375 P PPL P P PP P P PPPPP P P PPP PP P P Sbjct: 703 PPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPV 762 Query: 374 XXFXXXP 354 F P Sbjct: 763 LPFGLTP 769 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P PP P P PPPP P PPPP PPP P Sbjct: 573 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPP 620 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPPP P PPP PPP P P Sbjct: 664 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPP--PPPLPGEAGMPP 715 Score = 40.3 bits (90), Expect = 0.009 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PP P PPPP PP PPPPPP PP P Sbjct: 598 PPPAPGDSTTPPPP--PPPPPPPPPLPGGVCISSPPSLP 634 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPP----XPXXPPP 415 P P P PPPP P P PPPP P P P PP P PPP Sbjct: 688 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPP 741 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PP P PPPPP P P PP P Sbjct: 584 PAPPLPGDSGTIIPPPPAPGDSTTPPPPPP-PPPPPPPLP 622 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP PP P PPPPP P P P P P P F Sbjct: 676 PPPPPLPGSARIPPPP--PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPF 732 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX----PPXPPPPP-PXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P P PP PP Sbjct: 702 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPP 749 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P P PPPPP P PP P Sbjct: 715 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVP 758 Score = 37.1 bits (82), Expect = 0.085 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 11/50 (22%) Frame = -1 Query: 536 PPLXPPPXPXPPPP-----XXPPXPP------PPPPXXPXXXXPPPPXXP 420 PP PPP P PP P PP P PPPP PPPP P Sbjct: 609 PPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 658 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = -1 Query: 542 PXPPLXPPPX------PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P PP P PPPPPP PPP PPP P Sbjct: 581 PVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPP------PPPP---PPPLP 622 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPPP PP P Sbjct: 678 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 730 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PPPP P P PPP P P P PPP P F Sbjct: 701 PPPPPPLPGEAGMPPPPPPLPGGPGIPPP--PPFPGGPGIPPPPPGMGMPPPPPFGF 755 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPP-----XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P PP P P Sbjct: 666 PSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGP 724 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPPP P P P P Sbjct: 690 PPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 733 Score = 34.7 bits (76), Expect = 0.46 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PP PPP P PPPPPP Sbjct: 577 PSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPP 620 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXP---XPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPP P P PP P PP Sbjct: 573 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPP 618 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP PPPP PPPPP P P Sbjct: 715 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 761 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PPPPP P P P P P Sbjct: 664 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 708 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP P PPPP P PP Sbjct: 597 PPPPAPGDSTTPPPPPPPPP-PPPPLPGGVCISSPP 631 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP----PXPP--------PPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPPP P P PPPP P PPP PPP P Sbjct: 641 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPP--PPPLP 695 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPP-PXXPRXPXPPXP 430 P PP P P P PPPPP P R P PP P Sbjct: 652 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPP 693 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 15/53 (28%) Frame = -1 Query: 521 PPXPXPPPPXXPPXP-------PPPPPXXPXXXXPPP--------PXXPPPXP 408 PP P PPPP PP P PP P PPP P PPP P Sbjct: 608 PPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPP--PPPLP 658 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PPPP PP P PPP Sbjct: 574 PSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPP 616 >AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. Length = 179 Score = 49.6 bits (113), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PPL PPPP P PPPPPP PPPP P P PF Sbjct: 61 PPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGP 120 Query: 371 XFXXXPXXXXXXPXPXF 321 P P P F Sbjct: 121 GIPPPPPGMGMPPPPPF 137 Score = 46.8 bits (106), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFSX 375 P PPL P P PP P P PPPPP P P PPP PP P P Sbjct: 87 PPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPV 146 Query: 374 XXFXXXP 354 F P Sbjct: 147 LPFGLTP 153 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPPP P PPP PPP P P Sbjct: 48 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPP--PPPLPGEAGMPP 99 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPP----XPXXPPP 415 P P P PPPP P P PPPP P P P PP P PPP Sbjct: 72 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPP 125 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP PP P PPPPP P P P P P P F Sbjct: 60 PPPPPLPGSARIPPPP--PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPF 116 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX----PPXPPPPP-PXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P P PP PP Sbjct: 86 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPP 133 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P P PPPPP P PP P Sbjct: 99 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVP 142 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPPP PP P Sbjct: 62 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 114 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PPPP P P PPP P P P PPP P F Sbjct: 85 PPPPPPLPGEAGMPPPPPPLPGGPGIPPP--PPFPGGPGIPPPPPGMGMPPPPPFGF 139 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-----PXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P PP P P Sbjct: 50 PSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGP 108 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPPP P P P P Sbjct: 74 PPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 117 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP PPPP PPPPP P P Sbjct: 99 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 145 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PPPPP P P P P P Sbjct: 48 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 92 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP----PXPP--------PPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPPP P P PPPP P PPP PPP P Sbjct: 25 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPP--PPPLP 79 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPP-PXXPRXPXPPXP 430 P PP P P P PPPPP P R P PP P Sbjct: 36 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPP 77 >AJ564104-1|CAD91892.1| 578|Homo sapiens keratin 1b protein. Length = 578 Score = 49.6 bits (113), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GGG G GGGG GG R G G Sbjct: 514 GSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 558 Score = 43.2 bits (97), Expect = 0.001 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGX----GGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GG GGG GG GG G G G G GG G Sbjct: 499 GAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGG 547 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GGG G GG GGG GG G G GG GG G Sbjct: 498 GGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYG 539 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G G G GGG GG G Sbjct: 510 GYGGGSGGGYGGGRSYRGGGARGGSGGGYGSG-CGGGGGSYGGSG 553 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G + RGG G G G G GGGGG G G G G Sbjct: 514 GSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 558 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGG G G GG G GG GG G G GG G Sbjct: 85 GGGVGGFGGGRGFGVGSTGAGGFG-GGGFGGAGFGTSNFGLGGFG 128 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G G GG GGG GGG G G G G G Sbjct: 502 GGGSYGSGGYGGGSG-GGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYG 550 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GG G G G G GG GG GG G G R Sbjct: 527 GGGARGGSG----GGYGSGCGGGGGSYGGSGRSGRGSSR 561 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G G GG GGG G G G G GGG GG G Sbjct: 81 GFCQGGGVGGFGGGRGFGVGSTGAGGFGGGGFGGAG 116 Score = 31.5 bits (68), Expect = 4.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGG-GGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G R GGG GG GG G G GG G Sbjct: 512 GGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSG 556 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G GGG G G GGG G G G Sbjct: 499 GAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCG 543 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GG G GGG G GGG G G G G Sbjct: 509 GGYGGGSGGGYGGGRSYRGGGARGGSGGGYGSGCGGGGGSYGGSGRSGRG 558 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 49.6 bits (113), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PPL PPPP P PPPPPP PPPP P P PF Sbjct: 656 PPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGP 715 Query: 371 XFXXXPXXXXXXPXPXF 321 P P P F Sbjct: 716 GIPPPPPGMGMPPPPPF 732 Score = 46.8 bits (106), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFSX 375 P PPL P P PP P P PPPPP P P PPP PP P P Sbjct: 682 PPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPV 741 Query: 374 XXFXXXP 354 F P Sbjct: 742 LPFGLTP 748 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P PP P P PPPP P PPPP PPP P Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPP 611 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP----PXXPPPXP 408 PP P PPPP PP PPPP P PPP PPP P Sbjct: 589 PPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPP 635 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PP PPP P PPP PPPP PPPP P Sbjct: 599 PPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLP 637 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPPP P PPP PPP P P Sbjct: 643 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPP--PPPLPGEAGMPP 694 Score = 40.3 bits (90), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP PPP P PP P PPPP PPPP Sbjct: 599 PPPPPPPPP-PPPPLPGGTAISPPPPLSGDATIPPPPP 635 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPP----XPXXPPP 415 P P P PPPP P P PPPP P P P PP P PPP Sbjct: 667 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPP 720 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PP P PPPPP P P PP P Sbjct: 575 PAPPLPGDSGTIIPPPPAPGDSTTPPPPPP-PPPPPPPLP 613 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP PP P PPPPP P P P P P P F Sbjct: 655 PPPPPLPGSARIPPPP--PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPF 711 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX----PPXPPPPP-PXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P P PP PP Sbjct: 681 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPP 728 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P P PPPPP P PP P Sbjct: 694 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVP 737 Score = 37.1 bits (82), Expect = 0.085 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -1 Query: 542 PXPPLXPPPXP-----XPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PPP P PPPP PPPP P P P P Sbjct: 603 PPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLP 649 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P PP PPP P PPPPPP P P Sbjct: 568 PSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPP 622 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPPP PP P Sbjct: 657 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 709 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PPPP P P PPP P P P PPP P F Sbjct: 680 PPPPPPLPGEAGMPPPPPPLPGGPGIPPP--PPFPGGPGIPPPPPGMGMPPPPPFGF 734 Score = 35.9 bits (79), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP P PPP P P PP Sbjct: 588 PPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPP 623 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPP-----XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P PP P P Sbjct: 645 PSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGP 703 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPPP P P P P Sbjct: 669 PPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 712 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXP---XPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPP P P PP P PP Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPP 609 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP PPPP PPPPP P P Sbjct: 694 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 740 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PPPPP P P P P P Sbjct: 643 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 687 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP----PXPP--------PPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPPP P P PPPP P PPP PPP P Sbjct: 620 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPP--PPPLP 674 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPP-PXXPRXPXPPXP 430 P PP P P P PPPPP P R P PP P Sbjct: 631 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPP 672 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PPPP PP P PPP Sbjct: 565 PSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPP 607 Score = 31.5 bits (68), Expect = 4.2 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 6/64 (9%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPP------PPPPXXPRXPXPPX 433 P P P P PPPP PP P PPPP PP Sbjct: 574 PPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPP 633 Query: 432 PXXP 421 P P Sbjct: 634 PPLP 637 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P P PPPP PPPP P P P P PL Sbjct: 606 PPPPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPL 660 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 49.6 bits (113), Expect = 1e-05 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX---PPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXX 372 P PPL PPPP P PPPPPP PPPP P P PF Sbjct: 704 PPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGP 763 Query: 371 XFXXXPXXXXXXPXPXF 321 P P P F Sbjct: 764 GIPPPPPGMGMPPPPPF 780 Score = 46.8 bits (106), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 542 PXPPLXPP---PXPXPPPPXXPPXPPPPP-PXXPXXXXPPPPXXPPPXPXXXXKXPFFSX 375 P PPL P P PP P P PPPPP P P PPP PP P P Sbjct: 730 PPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPV 789 Query: 374 XXFXXXP 354 F P Sbjct: 790 LPFGLTP 796 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPPXP 408 PP P P PP P P PPPP P PPPP PPP P Sbjct: 600 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPP 647 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPP P PPPPP P PPP PPP P P Sbjct: 691 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPP--PPPLPGEAGMPP 742 Score = 40.3 bits (90), Expect = 0.009 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PP P PPPP PP PPPPPP PP P Sbjct: 625 PPPAPGDSTTPPPP--PPPPPPPPPLPGGVCISSPPSLP 661 Score = 40.3 bits (90), Expect = 0.009 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 9/54 (16%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPP----XPXXPPP 415 P P P PPPP P P PPPP P P P PP P PPP Sbjct: 715 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPP 768 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P P P PP P PPPPP P P PP P Sbjct: 611 PAPPLPGDSGTIIPPPPAPGDSTTPPPPPP-PPPPPPPLP 649 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXP-----PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLF 382 P PP PPPP PP P PPPPP P P P P P P F Sbjct: 703 PPPPPLPGSARIPPPP--PPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPF 759 Score = 38.3 bits (85), Expect = 0.037 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX----PPXPPPPP-PXXPRXPXPPXPXXPPP 415 P PP PPPP P PPPPP P P P PP PP Sbjct: 729 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPP 776 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P P PPPPP P PP P Sbjct: 742 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVP 785 Score = 37.1 bits (82), Expect = 0.085 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 11/50 (22%) Frame = -1 Query: 536 PPLXPPPXPXPPPP-----XXPPXPP------PPPPXXPXXXXPPPPXXP 420 PP PPP P PP P PP P PPPP PPPP P Sbjct: 636 PPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLP 685 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = -1 Query: 542 PXPPLXPPPX------PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P P PP P PPPPPP PPP PPP P Sbjct: 608 PVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPP------PPPP---PPPLP 649 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP----XPPPPPPXXXPXPXPPXP 431 P P P PP PPPP P PPPPPP PP P Sbjct: 705 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 757 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPLFF 379 P P P PPPP P P PPP P P P PPP P F Sbjct: 728 PPPPPPLPGEAGMPPPPPPLPGGPGIPPP--PPFPGGPGIPPPPPGMGMPPPPPFGF 782 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPP-----XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P PPPP P PPPP P P PP P P Sbjct: 693 PSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGP 751 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PP P PPPPP P P P P Sbjct: 717 PPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 760 Score = 34.7 bits (76), Expect = 0.46 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PP PPP P PPPPPP Sbjct: 604 PSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPP 647 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXP---XPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPPP P P PP P PP Sbjct: 600 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPP 645 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PP PPPP PPPPP P P Sbjct: 742 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAP 788 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P PPP PPPPP P P P P P Sbjct: 691 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLP 735 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP P PPPP P PP Sbjct: 624 PPPPAPGDSTTPPPPPPPPP-PPPPLPGGVCISSPP 658 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP----PXPP--------PPPPXXPXXXXPPPPXXPPPXP 408 P PPL PPPP P P PPPP P PPP PPP P Sbjct: 668 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPP--PPPLP 722 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP---PXPPPPP-PXXPRXPXPPXP 430 P PP P P P PPPPP P R P PP P Sbjct: 679 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPP 720 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 15/53 (28%) Frame = -1 Query: 521 PPXPXPPPPXXPPXP-------PPPPPXXPXXXXPPP--------PXXPPPXP 408 PP P PPPP PP P PP P PPP P PPP P Sbjct: 635 PPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPP--PPPLP 685 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PPPP PP P PPP Sbjct: 601 PSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPP 643 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 49.6 bits (113), Expect = 1e-05 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 9/50 (18%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP---------PPXXPXXXXPPPPXXPPP 414 PP P P PPPP PP PPPP PP P PP P PPP Sbjct: 596 PPPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPP 645 Score = 45.2 bits (102), Expect = 3e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P P PP PP PPPPPP P P PP P Sbjct: 596 PPPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQP 632 Score = 44.0 bits (99), Expect = 7e-04 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 9/49 (18%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXPPXPPPP---------PPXXPRXPXPPXPXXPPP 415 PP PPPP PP PPPP PP P PP P PPP Sbjct: 597 PPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPP 645 Score = 38.7 bits (86), Expect = 0.028 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPP 465 L PP PPPP PP PPPPP Sbjct: 635 LLPPRPDGPPPPEYPPPPPPPP 656 Score = 37.1 bits (82), Expect = 0.085 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 P PP P PPP P PPPPPP Sbjct: 632 PAYLLPPRPDGPPPPEYPPPPPPPP 656 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PP P PP P P P P P PPP Sbjct: 597 PPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPP 656 Score = 36.3 bits (80), Expect = 0.15 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 7/60 (11%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPX---PP----PPPPXXXPXPXPP 437 P P P P P PP P PP P PP PPPP P P PP Sbjct: 596 PPPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPP 655 Score = 34.7 bits (76), Expect = 0.46 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP P PPPP PPP P P Sbjct: 596 PPPAPTPPQQPPPPPPPPPPPPPYLASLP 624 Score = 34.7 bits (76), Expect = 0.46 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 501 PPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 PP P PP P P P P P PPP Sbjct: 1135 PPEPPAGPPAPAPRPDERPSSPIPLLPPP 1163 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P PP P P P P PPP Sbjct: 1123 PTEESPPSAPLRPPEPPAGPPAPAPRPDERPSSPIPLLPPP 1163 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 487 PXPPPPPPXXXPXPXPPXPXXXPPLXXXXXXNXPFFP 377 P P P PP P P PP P P L P P Sbjct: 596 PPPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQP 632 >BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 protein. Length = 1542 Score = 48.8 bits (111), Expect = 3e-05 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP-PXXP----XXXXPPPPXXPP 417 PPL PPP P PPP PP PPPPP P P P P PP Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPP 1510 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 1466 PPLPPPPPPPLPP---PPPPPLPPPPP 1489 Score = 39.9 bits (89), Expect = 0.012 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP PPP PP P PPPP P Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPPLPKTP 1494 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP P P R P P PP Sbjct: 1467 PLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPP 1510 Score = 30.3 bits (65), Expect = 9.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXP 420 P PP PPP P P P P P P PP P Sbjct: 1479 PPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPPQQPLP 1520 >BC030289-1|AAH30289.1| 180|Homo sapiens SIX3 protein protein. Length = 180 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GGG G GGG G GG GG G G GGG R Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSR 71 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G G GG G G G GGGG GG GGGG G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GGG GG G GG G GG GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GGG GG GGG G G GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 455 GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGGG GG GGG GG G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGG 66 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 R + G G G GG G G G GG G GGG Sbjct: 25 RSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGG 65 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G G G GG G G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G GGG G GG G G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 >AL162671-1|CAB83141.1| 164|Homo sapiens human homeobox protein SIX3 (NP_005404) protein. Length = 164 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GGG G GGG G GG GG G G GGG R Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSR 71 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G G GG G G G GGGG GG GGGG G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GGG GG G GG G GG GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GGG GG GGG G G GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 455 GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGGG GG GGG GG G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGG 66 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 R + G G G GG G G G GG G GGG Sbjct: 25 RSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGG 65 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G G G GG G G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G GGG G GG G G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 >AJ012611-1|CAB42539.1| 332|Homo sapiens SIX3 protein protein. Length = 332 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GGG G GGG G GG GG G G GGG R Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSR 71 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G G GG G G G GGGG GG GGGG G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GGG GG G GG G GG GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GGG GG GGG G G GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 455 GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGGG GG GGG GG G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGG 66 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 R + G G G GG G G G GG G GGG Sbjct: 25 RSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGG 65 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G G G GG G G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G GGG G GG G G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 >AF092047-1|AAD11939.1| 332|Homo sapiens homeobox protein Six3 protein. Length = 332 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GGG G GGG G GG GG G G GGG R Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSR 71 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G G GG G G G GGGG GG GGGG G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GGG GG G GG G GG GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GGG GG GGG G G GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 455 GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGGG GG GGG GG G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGG 66 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 R + G G G GG G G G GG G GGG Sbjct: 25 RSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGG 65 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G G G GG G G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G GGG G GG G G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 >AF083891-1|AAD51091.1| 332|Homo sapiens SIX3 protein protein. Length = 332 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GGG G GGG G GG GG G G GGG R Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSR 71 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G G GG G G G GGGG GG GGGG G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GGG GG G GG G GG GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GGG GG GGG G G GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 455 GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGGG GG GGG GG G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGG 66 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 R + G G G GG G G G GG G GGG Sbjct: 25 RSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGG 65 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G G G GG G G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G GGG G GG G G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 >AF049339-1|AAD15753.1| 332|Homo sapiens Six3 protein. Length = 332 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GGG G GGG G GG GG G G GGG R Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSR 71 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G G GG G G G GGGG GG GGGG G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GGG GG G GG G GG GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GGG GG GGG G G GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 455 GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGGG GG GGG GG G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGG 66 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 R + G G G GG G G G GG G GGG Sbjct: 25 RSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGG 65 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G G G GG G G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G GGG G GG G G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 >AC012354-1|AAX93283.1| 332|Homo sapiens unknown protein. Length = 332 Score = 48.8 bits (111), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR 531 GGG GGG G GGG G GG GG G G GGG R Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSR 71 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G G GG G G G GGGG GG GGGG G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 436 GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG GGG GG G GG G GG GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G G GGG GG GGG G G GG G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 455 GXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G GGGGG GG GGG GG G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGG 66 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGG 508 R + G G G GG G G G GG G GGG Sbjct: 25 RSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGG 65 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G G GGG GG G G G GG G G Sbjct: 33 GGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGG 69 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G GG G GGG G GG G G G Sbjct: 35 GNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGG 68 >AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB) protein. Length = 1542 Score = 48.8 bits (111), Expect = 3e-05 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP-PXXP----XXXXPPPPXXPP 417 PPL PPP P PPP PP PPPPP P P P P PP Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPP 1510 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 1466 PPLPPPPPPPLPP---PPPPPLPPPPP 1489 Score = 39.9 bits (89), Expect = 0.012 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP PPP PP P PPPP P Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPPLPKTP 1494 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP P P R P P PP Sbjct: 1467 PLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPP 1510 Score = 30.3 bits (65), Expect = 9.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXP 420 P PP PPP P P P P P P PP P Sbjct: 1479 PPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPPQQPLP 1520 >AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. Length = 1605 Score = 48.8 bits (111), Expect = 3e-05 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP-PXXP----XXXXPPPPXXPP 417 PPL PPP P PPP PP PPPPP P P P P PP Sbjct: 1529 PPLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPP 1573 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPPPPP P PPPP PPP P Sbjct: 1529 PPLPPPPPPPLPP---PPPPPLPPPPP 1552 Score = 39.9 bits (89), Expect = 0.012 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PP PPP PP P PPPP P Sbjct: 1529 PPLPPPPPPPLPPPPPPPLPPPPPLPKTP 1557 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PP PPP PP P P R P P PP Sbjct: 1530 PLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPP 1573 Score = 30.3 bits (65), Expect = 9.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP-PPPPPXXPXXXXPPPPXXP 420 P PP PPP P P P P P P PP P Sbjct: 1542 PPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPPQQPLP 1583 >X64624-1|CAA45907.1| 331|Homo sapiens RDC-1 protein. Length = 331 Score = 48.4 bits (110), Expect = 3e-05 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRG 534 GGG GGGG G GGG GGG GG GGGG G GGG G Sbjct: 63 GGGPRGGGG----GPGGGGPGGGGGGAAGGGGGGPGGGLLG 99 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G GGGGG GG GGGG G GG GG G Sbjct: 53 GGGGAHDAAGGG---GPRGGGGGPGGGGPGGGGGGAAGGGGGGPG 94 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGG G G GGGG GG GG G GGG GG Sbjct: 54 GGGAHDAAGGGGPRGGGGGPGGGGPGGGGGGAAGGGGGGPGGG 96 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG GGG G GG GGGG G GGG G G Sbjct: 45 GAGARRGAGGGGAHDAAGGGGPRGGGGGPGGGGPGGGGGGAAGGG 89 Score = 42.3 bits (95), Expect = 0.002 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +1 Query: 409 GXGGGXX----GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGGG G GGGG GG GGG G GGG GG Sbjct: 51 GAGGGGAHDAAGGGGPRGGGGGPGGGGPGGG--GGGAAGGGGGGPGG 95 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G G GGGGG GG GGGG GG G G Sbjct: 54 GGGAHDAAGGG--GPRGGGGGPGGGGPGGGGGGAAGGGGGGPGGG 96 Score = 35.9 bits (79), Expect = 0.20 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGG--GGXGGXXGG--GGXXXXXXXGGXXGXG 550 G G GG G GGGG GG GG GG GG GG G G Sbjct: 47 GARRGAGGGGAHDAAGGGGPRGGGGGPGGGGPGGGGGGAAGGGGGGPG 94 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGG----GXGXXGGGGXG 512 GG G GG G G GGGGG G G GGG G Sbjct: 64 GGPRGGGGGPGGGGPGGGGGGAAGGGGGGPGGGLLG 99 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G G GGG GGGG G GG G G G Sbjct: 51 GAGGGGAHDAAGGGGPRGGGGGPGGGGPGGGGGGAAGGGGGGPGGG 96 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G GG G GGGG G GG G GG G Sbjct: 62 GGGGPRGGGGGPGGGGPGGGGGGAAGGGGGGPGGGLLG 99 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL PPP PP PP PPPPPP PPP P P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 47.6 bits (108), Expect = 6e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXP------PPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP PPP PP PPPPP PPPP PPP P Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PPP P PPPP PPP PPP P P Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 46.0 bits (104), Expect = 2e-04 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 16/61 (26%) Frame = -1 Query: 542 PXPPLX-----PPPXPXPPPP---XXPPXPPPP--------PPXXPXXXXPPPPXXPPPX 411 P PP+ PPP P PPP PP PPPP PP P PP P PPP Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPP 400 Query: 410 P 408 P Sbjct: 401 P 401 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX------PPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P PPPP PP PPPPPP P PP PP Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP PP PP P P PP P Sbjct: 362 PGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPP P PPPP P P P P P Sbjct: 369 PPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXX--PRXPXPPXPXXPPPXXXXXXXT 391 P P PP PPPP P PPPPP P P PP P PP Sbjct: 354 PTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Query: 390 PL 385 PL Sbjct: 414 PL 415 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPP---XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPPPP P PP P PP Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPP 403 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXX---PPXPPPPPPXXPRXPXPPXPXX 424 P P P P P PPPP PP PPPPPP P P Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAP 412 Query: 423 PP 418 PP Sbjct: 413 PP 414 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PP P PPPPP P PP P Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPP 385 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P PP PP PPPP P PP P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PP PPP P P P PP PP P P Sbjct: 392 PMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAP 427 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = -3 Query: 534 PPXXXXXXXPPP-PXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 PP PPP P PP P PPPPP P P PP Sbjct: 343 PPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPP 386 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL PPP PP PP PPPPPP PPP P P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 47.6 bits (108), Expect = 6e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXP------PPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP PPP PP PPPPP PPPP PPP P Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PPP P PPPP PPP PPP P P Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 46.0 bits (104), Expect = 2e-04 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 16/61 (26%) Frame = -1 Query: 542 PXPPLX-----PPPXPXPPPP---XXPPXPPPP--------PPXXPXXXXPPPPXXPPPX 411 P PP+ PPP P PPP PP PPPP PP P PP P PPP Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPP 400 Query: 410 P 408 P Sbjct: 401 P 401 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX------PPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P PPPP PP PPPPPP P PP PP Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP PP PP P P PP P Sbjct: 362 PGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPP P PPPP P P P P P Sbjct: 369 PPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXX--PRXPXPPXPXXPPPXXXXXXXT 391 P P PP PPPP P PPPPP P P PP P PP Sbjct: 354 PTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Query: 390 PL 385 PL Sbjct: 414 PL 415 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPP---XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPPPP P PP P PP Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPP 403 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXX---PPXPPPPPPXXPRXPXPPXPXX 424 P P P P P PPPP PP PPPPPP P P Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAP 412 Query: 423 PP 418 PP Sbjct: 413 PP 414 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PP P PPPPP P PP P Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPP 385 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P PP PP PPPP P PP P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PP PPP P P P PP PP P P Sbjct: 392 PMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAP 427 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = -3 Query: 534 PPXXXXXXXPPP-PXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 PP PPP P PP P PPPPP P P PP Sbjct: 343 PPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPP 386 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = -1 Query: 542 PXPPLXP---PPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXP 420 P PP P P P PPPP P PPPPPP P PPPP P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP----XXPXXXXPPPPXXPPPXP 408 P P PP P P P PPPPPP P PPPP PPP P Sbjct: 337 PPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGP 385 Score = 45.2 bits (102), Expect = 3e-04 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 9/59 (15%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXPXXXXKXP 387 PP PPP P PPP PPPPP P PPPP PPP P P Sbjct: 288 PPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPPPPPNRMYPPP 346 Score = 44.0 bits (99), Expect = 7e-04 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P PPPP PPPPP PPPP PP P P Sbjct: 288 PPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPP--PPSRPSVEVPPP 337 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX-PPPPPPXXPXXXXPPPPXX------PPPXPXXXXKXP 387 P PP P PPP P PPPPPP P PPPP PP P P Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPPPPPNRMYPPPPPALPSSAPSGP 358 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPP P PPPP PPPP P P P Sbjct: 312 PPPSRAPTAAPPPPPPSRPSVEVPPPPPN-RMYPPPPPALPSSAPSGPPPPP 362 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP PPPPP P PP P P Sbjct: 277 PPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 42.3 bits (95), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 8/50 (16%) Frame = -1 Query: 533 PLXPPPXP-XPPPPXXPPXP--PPPPPXXPXXXXPPPP-----XXPPPXP 408 P PPP PPPP PP PPPPP PPPP PPP P Sbjct: 277 PPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPP 326 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXP 408 P PP P P PPPP PPPPP PPP P PP P Sbjct: 279 PPPPSRGGPPPPPPPPH-SSGPPPPPARGRGAPPPPPSRAPTAAPPPP 325 Score = 41.5 bits (93), Expect = 0.004 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPP--PPXXPPXPPPPPPXX----PRXPXPPXPXXPPP 415 P PP PP P P PPPPPP P P PP P PPP Sbjct: 335 PPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPP 383 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP--XPPPPPPXXXPXPXPPXP 431 P P P P PP P PPP P PPPPPP PP P Sbjct: 282 PSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPPPP 338 Score = 41.1 bits (92), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P PPPP PPPPP PPP PPP Sbjct: 323 PPPPPSRPSVEVPPPPPNRMYPPPPPALPSSAPSGPPP--PPP 363 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 4/63 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXX-PXPPPPXXPX---PPPPPPXXXPXPXPPXPX 428 P P P P PP P PPPP P PPPPP P P P P Sbjct: 293 PPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPPPPPNRMYPPPPPALPS 352 Query: 427 XXP 419 P Sbjct: 353 SAP 355 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PPPPP P P P PPP Sbjct: 323 PPPPPSRPSVEVPPPPPNRMYPPPPPALPSSAPSGPPP--PPP 363 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP P PPP P PPPPPP P P P Sbjct: 359 PPPPPSVLGVGPVAPPP--PPPPPPPPGPPPPPGLP 392 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PPPP P PP P P PP P PP Sbjct: 346 PPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P P P P P PPPP P P PPPP P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 37.5 bits (83), Expect = 0.065 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP 445 P P P PPP PP PPP PP P P Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 37.1 bits (82), Expect = 0.085 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 11/65 (16%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP------PXXPXPPPPP-----PXXXPXPXPPXP 431 P P PP P PPP P P PPPP P P P PP P Sbjct: 322 PPPPPPSRPSVEVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPP 381 Query: 430 XXXPP 416 PP Sbjct: 382 PPGPP 386 >BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PPL P PPPP P PPPPP P PPP P Sbjct: 553 PPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 593 Score = 45.6 bits (103), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPP P PPPPPP P PPPP PPP Sbjct: 539 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGG--PPPPPGPPP 582 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPP P PPPPPP P PP P PPL Sbjct: 539 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPL--PPGGPPPPPGPPPL 583 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPPPP P PPPP PP Sbjct: 531 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPP 571 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 P P PPPP PP P PPPPP P PP P PP Sbjct: 536 PGGPFPSSVPGSLLPPPP-PPPLPGGMLPPPPPPLPPGGPPPPPGPPP 582 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PPXP 408 P P P P P P PPPPP PPPP P PP P Sbjct: 531 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 577 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP----XPPPPPPXXPRXPXPPXP 430 P P PP PPPP PP PP PPP P P P Sbjct: 550 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 593 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P PPP P PPP P P P Sbjct: 564 PPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQP 606 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPP P P PP P PP Sbjct: 531 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPP 575 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = -1 Query: 542 PXPPLXP---PPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXP 420 P PP P P P PPPP P PPPPPP P PPPP P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP----XXPXXXXPPPPXXPPPXP 408 P P PP P P P PPPPPP P PPPP PPP P Sbjct: 337 PPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGP 385 Score = 44.8 bits (101), Expect = 4e-04 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 17/69 (24%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX------PPXP--------PPPPPXXPXXXXPPPP---XXPPP 414 P PP PP PPPP PP P PPPPP P PPPP PPP Sbjct: 287 PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPP 346 Query: 413 XPXXXXKXP 387 P P Sbjct: 347 PPALPSSAP 355 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX-PPPPPPXXPXXXXPPPPXX------PPPXPXXXXKXP 387 P PP P PPP P PPPPPP P PPPP PP P P Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGP 358 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPP P PPPP PPPP P P P Sbjct: 312 PPPSRAPTAAPPPPPPSRPSVAVPPPPPN-RMYPPPPPALPSSAPSGPPPPP 362 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP PPPPP P PP P P Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPP---XPPPPPPXXPXXXXPPPP-----XXPPPXP 408 P PPP PPP PP PPPPP PPPP PPP P Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPP 326 Score = 41.5 bits (93), Expect = 0.004 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXP 408 P PP P P PPPP PPPPP PPP P PP P Sbjct: 279 PPPPSRGGPPPPPPPPH-NSGPPPPPARGRGAPPPPPSRAPTAAPPPP 325 Score = 41.5 bits (93), Expect = 0.004 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPP--PPXXPPXPPPPPPXX----PRXPXPPXPXXPPP 415 P PP PP P P PPPPPP P P PP P PPP Sbjct: 335 PPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPP 383 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP--XPPPPPPXXXPXPXPPXP 431 P P P P PP P PPP P PPPPPP PP P Sbjct: 282 PSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPP 338 Score = 41.1 bits (92), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P PPPP PPPPP PPP PPP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP--PPP 363 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 4/63 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXX-PXPPPPXXPX---PPPPPPXXXPXPXPPXPX 428 P P P P PP P PPPP P PPPPP P P P P Sbjct: 293 PPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPS 352 Query: 427 XXP 419 P Sbjct: 353 SAP 355 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PPPPP P P P PPP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP--PPP 363 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP P PPP P PPPPPP P P P Sbjct: 359 PPPPPSVLGVGPVAPPP--PPPPPPPPGPPPPPGLP 392 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PPPP P PP P P PP P PP Sbjct: 346 PPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P P P P P PPPP P P PPPP P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 37.5 bits (83), Expect = 0.065 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP 445 P P P PPP PP PPP PP P P Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 37.1 bits (82), Expect = 0.085 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 11/65 (16%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP------PXXPXPPPPP-----PXXXPXPXPPXP 431 P P PP P PPP P P PPPP P P P PP P Sbjct: 322 PPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPP 381 Query: 430 XXXPP 416 PP Sbjct: 382 PPGPP 386 >BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PPL P PPPP P PPPPP P PPP P Sbjct: 553 PPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 593 Score = 45.6 bits (103), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPP P PPPPPP P PPPP PPP Sbjct: 539 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGG--PPPPPGPPP 582 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPP P PPPPPP P PP P PPL Sbjct: 539 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPL--PPGGPPPPPGPPPL 583 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPPPP P PPPP PP Sbjct: 531 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPP 571 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 P P PPPP PP P PPPPP P PP P PP Sbjct: 536 PGGPFPSSVPGSLLPPPP-PPPLPGGMLPPPPPPLPPGGPPPPPGPPP 582 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PPXP 408 P P P P P P PPPPP PPPP P PP P Sbjct: 531 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 577 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP----XPPPPPPXXPRXPXPPXP 430 P P PP PPPP PP PP PPP P P P Sbjct: 550 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 593 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P PPP P PPP P P P Sbjct: 564 PPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQP 606 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPP P P PP P PP Sbjct: 531 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPP 575 >BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled associated activator of morphogenesis 2 protein. Length = 662 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PPL P PPPP P PPPPP P PPP P Sbjct: 147 PPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 187 Score = 45.6 bits (103), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPP P PPPPPP P PPPP PPP Sbjct: 133 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGG--PPPPPGPPP 176 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPP P PPPPPP P PP P PPL Sbjct: 133 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPL--PPGGPPPPPGPPPL 177 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPPPP P PPPP PP Sbjct: 125 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPP 165 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 P P PPPP PP P PPPPP P PP P PP Sbjct: 130 PGGPFPSSVPGSLLPPPP-PPPLPGGMLPPPPPPLPPGGPPPPPGPPP 176 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PPXP 408 P P P P P P PPPPP PPPP P PP P Sbjct: 125 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 171 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP----XPPPPPPXXPRXPXPPXP 430 P P PP PPPP PP PP PPP P P P Sbjct: 144 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 187 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P PPP P PPP P P P Sbjct: 158 PPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQP 200 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPP P P PP P PP Sbjct: 125 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPP 169 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL PPP PP PP PPPPPP PPP P P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 47.6 bits (108), Expect = 6e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXP------PPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP PPP PP PPPPP PPPP PPP P Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PPP P PPPP PPP PPP P P Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 46.0 bits (104), Expect = 2e-04 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 16/61 (26%) Frame = -1 Query: 542 PXPPLX-----PPPXPXPPPP---XXPPXPPPP--------PPXXPXXXXPPPPXXPPPX 411 P PP+ PPP P PPP PP PPPP PP P PP P PPP Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPP 400 Query: 410 P 408 P Sbjct: 401 P 401 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX------PPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P PPPP PP PPPPPP P PP PP Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP PP PP P P PP P Sbjct: 362 PGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPP P PPPP P P P P P Sbjct: 369 PPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXX--PRXPXPPXPXXPPPXXXXXXXT 391 P P PP PPPP P PPPPP P P PP P PP Sbjct: 354 PTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Query: 390 PL 385 PL Sbjct: 414 PL 415 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPP---XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPPPP P PP P PP Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPP 403 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXX---PPXPPPPPPXXPRXPXPPXPXX 424 P P P P P PPPP PP PPPPPP P P Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAP 412 Query: 423 PP 418 PP Sbjct: 413 PP 414 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PP P PPPPP P PP P Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPP 385 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P PP PP PPPP P PP P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PP PPP P P P PP PP P P Sbjct: 392 PMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAP 427 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = -3 Query: 534 PPXXXXXXXPPP-PXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 PP PPP P PP P PPPPP P P PP Sbjct: 343 PPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPP 386 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL PPP PP PP PPPPPP PPP P P Sbjct: 392 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 433 Score = 47.6 bits (108), Expect = 6e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXP------PPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP PPP PP PPPPP PPPP PPP P Sbjct: 363 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPP 416 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PPP P PPPP PPP PPP P P Sbjct: 371 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 422 Score = 46.0 bits (104), Expect = 2e-04 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 16/61 (26%) Frame = -1 Query: 542 PXPPLX-----PPPXPXPPPP---XXPPXPPPP--------PPXXPXXXXPPPPXXPPPX 411 P PP+ PPP P PPP PP PPPP PP P PP P PPP Sbjct: 353 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPP 412 Query: 410 P 408 P Sbjct: 413 P 413 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX------PPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P PPPP PP PPPPPP P PP PP Sbjct: 382 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 429 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP PP PP P P PP P Sbjct: 374 PGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 422 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPP P PPPP P P P P P Sbjct: 381 PPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 433 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXX--PRXPXPPXPXXPPPXXXXXXXT 391 P P PP PPPP P PPPPP P P PP P PP Sbjct: 366 PTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 425 Query: 390 PL 385 PL Sbjct: 426 PL 427 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPP---XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPPPP P PP P PP Sbjct: 363 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPP 415 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXX---PPXPPPPPPXXPRXPXPPXPXX 424 P P P P P PPPP PP PPPPPP P P Sbjct: 365 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAP 424 Query: 423 PP 418 PP Sbjct: 425 PP 426 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PP P PPPPP P PP P Sbjct: 353 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPP 397 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P PP PP PPPP P PP P Sbjct: 392 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 433 Score = 35.9 bits (79), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PP PPP P P P PP PP P P Sbjct: 404 PMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAP 439 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = -3 Query: 534 PPXXXXXXXPPP-PXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 PP PPP P PP P PPPPP P P PP Sbjct: 355 PPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPP 398 >AL355338-2|CAH70367.1| 532|Homo sapiens Zic family member 2 (odd-paired homolog, Drosophila) protein. Length = 532 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G G GG G GGGGG G GGG G G G GG Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGG 519 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG G GG G GGG GG GG GGG G GG G Sbjct: 481 GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 522 Score = 46.8 bits (106), Expect = 1e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G GG GGG G GGGG G GGG G G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGG 513 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G G GG GG GGGG G GG G G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAG 518 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G GG G G GGGGGG G GGG G GG G Sbjct: 481 GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 522 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GGG G G G G GGG GG GGGG G G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGG 519 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G GG GGG G GGGG GG G G G G Sbjct: 478 GGSGSGGAGGGSGGGSGSGGGGGGA--GGGGGGSSGGGSGTAGGHSG 522 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G GGG G G GGG G GG G G Sbjct: 476 RGGGS-GSGGAGGG---SGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 522 >AF193855-1|AAG28409.1| 532|Homo sapiens zinc finger protein of cerebellum ZIC2 protein. Length = 532 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G G GG G GGGGG G GGG G G G GG Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGG 519 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG G GG G GGG GG GG GGG G GG G Sbjct: 481 GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 522 Score = 46.8 bits (106), Expect = 1e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G GG GGG G GGGG G GGG G G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGG 513 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G G GG GG GGGG G GG G G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAG 518 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G GG G G GGGGGG G GGG G GG G Sbjct: 481 GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 522 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GGG G G G G GGG GG GGGG G G Sbjct: 477 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGG 519 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G GG GGG G GGGG GG G G G G Sbjct: 478 GGSGSGGAGGGSGGGSGSGGGGGGA--GGGGGGSSGGGSGTAGGHSG 522 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G GGG G G GGG G GG G G Sbjct: 476 RGGGS-GSGGAGGG---SGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 522 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL PPP PP PP PPPPPP PPP P P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 47.6 bits (108), Expect = 6e-05 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = -1 Query: 542 PXPPLX---PPPXPXPPPPXXPPXP------PPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP PPP PP PPPPP PPPP PPP P Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPP 404 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P PPP P PPPP PPP PPP P P Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 46.0 bits (104), Expect = 2e-04 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 16/61 (26%) Frame = -1 Query: 542 PXPPLX-----PPPXPXPPPP---XXPPXPPPP--------PPXXPXXXXPPPPXXPPPX 411 P PP+ PPP P PPP PP PPPP PP P PP P PPP Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPP 400 Query: 410 P 408 P Sbjct: 401 P 401 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX------PPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P PPPP PP PPPPPP P PP PP Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPPP PP PP P P PP P Sbjct: 362 PGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGP 410 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P PP P PPP P PPPP P P P P P Sbjct: 369 PPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXP-----PXPPPPPPXX--PRXPXPPXPXXPPPXXXXXXXT 391 P P PP PPPP P PPPPP P P PP P PP Sbjct: 354 PTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 Query: 390 PL 385 PL Sbjct: 414 PL 415 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPP---XXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P PP P PPP P PPPPP P PP P PP Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPP 403 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXX---PPXPPPPPPXXPRXPXPPXPXX 424 P P P P P PPPP PP PPPPPP P P Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAP 412 Query: 423 PP 418 PP Sbjct: 413 PP 414 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PP P PPPPP P PP P Sbjct: 341 PLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPP 385 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP P P PP PP PPPP P PP P Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVP 421 Score = 35.9 bits (79), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 P PP PPP P P P PP PP P P Sbjct: 392 PMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAP 427 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = -3 Query: 534 PPXXXXXXXPPP-PXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 PP PPP P PP P PPPPP P P PP Sbjct: 343 PPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPP 386 >AF104902-1|AAC96325.1| 533|Homo sapiens ZIC2 protein protein. Length = 533 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G G GG G GGGGG G GGG G G G GG Sbjct: 478 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGG 520 Score = 48.4 bits (110), Expect = 3e-05 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GG G GG G GGG GG GG GGG G GG G Sbjct: 482 GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 523 Score = 46.8 bits (106), Expect = 1e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG G GG GGG G GGGG G GGG G G Sbjct: 478 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGG 514 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G G GG GG GGGG G GG G G Sbjct: 478 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAG 519 Score = 41.5 bits (93), Expect = 0.004 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G GG G G GGGGGG G GGG G GG G Sbjct: 482 GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 523 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GGG G G G G GGG GG GGGG G G Sbjct: 478 GGGSGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGG 520 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G GG GGG G GGGG GG G G G G Sbjct: 479 GGSGSGGAGGGSGGGSGSGGGGGGA--GGGGGGSSGGGSGTAGGHSG 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G GGG G G GGG G GG G G Sbjct: 477 RGGGS-GSGGAGGG---SGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSG 523 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 48.4 bits (110), Expect = 3e-05 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = -1 Query: 542 PXPPLXP---PPXPXPPPPXX----PPXPPPPPPXXPXXXXPPPPXXP 420 P PP P P P PPPP P PPPPPP P PPPP P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP----XXPXXXXPPPPXXPPPXP 408 P P PP P P P PPPPPP P PPPP PPP P Sbjct: 337 PPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGP 385 Score = 44.8 bits (101), Expect = 4e-04 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 17/69 (24%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXX------PPXP--------PPPPPXXPXXXXPPPP---XXPPP 414 P PP PP PPPP PP P PPPPP P PPPP PPP Sbjct: 287 PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPP 346 Query: 413 XPXXXXKXP 387 P P Sbjct: 347 PPALPSSAP 355 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 7/59 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPX-PPPPPPXXPXXXXPPPPXX------PPPXPXXXXKXP 387 P PP P PPP P PPPPPP P PPPP PP P P Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGP 358 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPP P PPPP PPPP P P P Sbjct: 312 PPPSRAPTAAPPPPPPSRPSVAVPPPPPN-RMYPPPPPALPSSAPSGPPPPP 362 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PPP PPPPP P PP P P Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRP 330 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPP---XPPPPPPXXPXXXXPPPP-----XXPPPXP 408 P PPP PPP PP PPPPP PPPP PPP P Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPP 326 Score = 41.5 bits (93), Expect = 0.004 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXP 408 P PP P P PPPP PPPPP PPP P PP P Sbjct: 279 PPPPSRGGPPPPPPPPH-NSGPPPPPARGRGAPPPPPSRAPTAAPPPP 325 Score = 41.5 bits (93), Expect = 0.004 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = -3 Query: 543 PXXPPXXXXXXXPP--PPXXPPXPPPPPPXX----PRXPXPPXPXXPPP 415 P PP PP P P PPPPPP P P PP P PPP Sbjct: 335 PPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPP 383 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXP--XPPPPPPXXXPXPXPPXP 431 P P P P PP P PPP P PPPPPP PP P Sbjct: 282 PSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPP 338 Score = 41.1 bits (92), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P PPPP PPPPP PPP PPP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP--PPP 363 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 4/63 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXX-PXPPPPXXPX---PPPPPPXXXPXPXPPXPX 428 P P P P PP P PPPP P PPPPP P P P P Sbjct: 293 PPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPS 352 Query: 427 XXP 419 P Sbjct: 353 SAP 355 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PPPP PPPPP P P P PPP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP--PPP 363 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP P PPP P PPPPPP P P P Sbjct: 359 PPPPPSVLGVGPVAPPP--PPPPPPPPGPPPPPGLP 392 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P P PPPP P PP P P PP P PP Sbjct: 346 PPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P P P P P PPPP P P PPPP P Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 37.5 bits (83), Expect = 0.065 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP 445 P P P PPP PP PPP PP P P Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 37.1 bits (82), Expect = 0.085 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 11/65 (16%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP------PXXPXPPPPP-----PXXXPXPXPPXP 431 P P PP P PPP P P PPPP P P P PP P Sbjct: 322 PPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPP 381 Query: 430 XXXPP 416 PP Sbjct: 382 PPGPP 386 >AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. Length = 1085 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PPL P PPPP P PPPPP P PPP P Sbjct: 560 PPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 600 Score = 45.6 bits (103), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 542 PXPPLXPPPX-PXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPP P PPPPPP P PPPP PPP Sbjct: 546 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGG--PPPPPGPPP 589 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P P PPP P PPPPPP P PP P PPL Sbjct: 546 PFPSSVPGSLLPPPPPPPLPGGMLPPPPPPL--PPGGPPPPPGPPPL 590 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P P P P PPPPPP P PPPP PP Sbjct: 538 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPP 578 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP----PPPPPXXPRXPXPPXPXXPP 418 P P PPPP PP P PPPPP P PP P PP Sbjct: 543 PGGPFPSSVPGSLLPPPP-PPPLPGGMLPPPPPPLPPGGPPPPPGPPP 589 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP--PPXP 408 P P P P P P PPPPP PPPP P PP P Sbjct: 538 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPP 584 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP----XPPPPPPXXPRXPXPPXP 430 P P PP PPPP PP PP PPP P P P Sbjct: 557 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 600 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP PP P PPP P PPP P P P Sbjct: 571 PPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQP 613 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP PPP P P PP P PP Sbjct: 538 PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPP 582 >M94077-1|AAA36181.1| 316|Homo sapiens loricrin protein. Length = 316 Score = 48.0 bits (109), Expect = 5e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGG---GXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GGG G G GGG GG G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGG 73 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG GG GG G GGG GG G Sbjct: 39 GGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCG 81 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GG GG G Sbjct: 41 GSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSG 85 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGGG G GGG GG GGGG GG Sbjct: 63 GCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXR--GGXG 543 G G G GGGG G GG GGG GG GG G G GG + GG G Sbjct: 48 GSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGG 95 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GGGG GG GGG G GGG GG G Sbjct: 38 GGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGG--GGIG 78 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG GG G G GGGGGG G GGG G GG G Sbjct: 55 GGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGG 99 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG G G GGG G GGG GG G Sbjct: 167 GGSSGGGSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GGGG G GGGG GGG G G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSG 266 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGGG GG GG GG GGG G G Sbjct: 56 GGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG--XGGGXRGG 537 GG GGGG G GGGG GG G G G GGG GG Sbjct: 21 GGGGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGG 62 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG GG G G GG G G G G G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGG G GGG GG G GG G G G Sbjct: 173 GSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSGSG 211 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG--------GGGXGXGGGXRGGXG 543 GGG GG G G GG G GG G GGG GGG GG G Sbjct: 235 GGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGG 285 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GG G G GG G Sbjct: 76 GIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGG 120 Score = 36.7 bits (81), Expect = 0.11 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG------GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G G GGGG GG G G GG GG G Sbjct: 92 GGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSG 142 Score = 35.5 bits (78), Expect = 0.26 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXXXXG 596 GG G G G GGGG G GGGG G G G G G G G G Sbjct: 21 GGGGGG--GGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGG 72 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G G G GG G GGGG G GG G G G Sbjct: 262 GIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG GG GG G GG G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GG G G G GGG G GGG G Sbjct: 117 GGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G F G G G G G GGG GG GGGG G Sbjct: 32 GGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGG 501 G G G + G G G GGG GGGG GG G Sbjct: 72 GGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSS 131 Query: 502 GGXGXGGGXRG 534 GG G GG G Sbjct: 132 GGGGSSGGGSG 142 Score = 34.3 bits (75), Expect = 0.60 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 2/92 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G GG G G G G G G G G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCF 177 Query: 462 XGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 GGGGG G GGG G G G G Sbjct: 178 SSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGX---GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GGG G GGGG G GG G G Sbjct: 78 GGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGG 125 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG GG G GG G GG G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIG 264 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GGGG G G G G GGG G G Sbjct: 162 GGVSSGGSSGGGSGCFSSGGGG-GSVCGYSGGGSGGGSGCGGG 203 Score = 33.1 bits (72), Expect = 1.4 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXX---GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG GG G GG GG G Sbjct: 248 GGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGG--GGGGSSVGGSG 294 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRG 534 G GGG G G G GGG GG GG G G +G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 32.7 bits (71), Expect = 1.8 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 3/95 (3%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXG-XGGXGXGXXXG 467 G GG G + G G G GG G GG G G G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Query: 468 GGGGGXGXXGGGG--XGXXXXXXGGXXGXGXXXXG 566 G GG GGGG G G G G G Sbjct: 83 GSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSG 117 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G GGG G GGG G GG GG G Sbjct: 79 GCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSG 127 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXG--GXXGGGGXGXGGG--XRGGXG 543 G G GGGG GGG GGG G GGG G G G GG G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGG 150 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGG--GXGXXGGGGXGXXXXXXGGXXG 545 G G G G G GGG G G GGGG G G G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGG G GG G G GGG G GGG G Sbjct: 230 GGGSSGGGGSGGSGCFSSG-GGGGSSGCGGGSSG 262 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GG G GG GG GG G Sbjct: 133 GGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSG 175 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGG GGG G GG G G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSS----GGGSGCFSSGGGGSSGGG 140 >M61120-1|AAA36180.1| 316|Homo sapiens loricrin protein. Length = 316 Score = 48.0 bits (109), Expect = 5e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGG---GXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GGG G G GGG GG G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGG 73 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG GG GG G GGG GG G Sbjct: 39 GGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCG 81 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GG GG G Sbjct: 41 GSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSG 85 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGGG G GGG GG GGGG GG Sbjct: 63 GCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXR--GGXG 543 G G G GGGG G GG GGG GG GG G G GG + GG G Sbjct: 48 GSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGG 95 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GGGG GG GGG G GGG GG G Sbjct: 38 GGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGG--GGIG 78 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG GG G G GGGGGG G GGG G GG G Sbjct: 55 GGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGG 99 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG G G GGG G GGG GG G Sbjct: 167 GGSSGGGSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GGGG G GGGG GGG G G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSG 266 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGGG GG GG GG GGG G G Sbjct: 56 GGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG--XGGGXRGG 537 GG GGGG G GGGG GG G G G GGG GG Sbjct: 21 GGGGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGG 62 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG GG G G GG G G G G G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGG G GGG GG G GG G G G Sbjct: 173 GSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSGSG 211 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG--------GGGXGXGGGXRGGXG 543 GGG GG G G GG G GG G GGG GGG GG G Sbjct: 235 GGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGG 285 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GG G G GG G Sbjct: 76 GIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGG 120 Score = 36.7 bits (81), Expect = 0.11 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG------GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G G GGGG GG G G GG GG G Sbjct: 92 GGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSG 142 Score = 35.5 bits (78), Expect = 0.26 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXXXXG 596 GG G G G GGGG G GGGG G G G G G G G G Sbjct: 21 GGGGGG--GGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGG 72 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G G G GG G GGGG G GG G G G Sbjct: 262 GIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG GG GG G GG G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GG G G G GGG G GGG G Sbjct: 117 GGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G F G G G G G GGG GG GGGG G Sbjct: 32 GGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGG 501 G G G + G G G GGG GGGG GG G Sbjct: 72 GGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSS 131 Query: 502 GGXGXGGGXRG 534 GG G GG G Sbjct: 132 GGGGSSGGGSG 142 Score = 34.3 bits (75), Expect = 0.60 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 2/92 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G GG G G G G G G G G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCF 177 Query: 462 XGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 GGGGG G GGG G G G G Sbjct: 178 SSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGX---GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GGG G GGGG G GG G G Sbjct: 78 GGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGG 125 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG GG G GG G GG G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIG 264 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GGGG G G G G GGG G G Sbjct: 162 GGVSSGGSSGGGSGCFSSGGGG-GSVCGYSGGGSGGGSGCGGG 203 Score = 33.1 bits (72), Expect = 1.4 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXX---GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG GG G GG GG G Sbjct: 248 GGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGG--GGGGSSVGGSG 294 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRG 534 G GGG G G G GGG GG GG G G +G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 32.7 bits (71), Expect = 1.8 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 3/95 (3%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXG-XGGXGXGXXXG 467 G GG G + G G G GG G GG G G G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Query: 468 GGGGGXGXXGGGG--XGXXXXXXGGXXGXGXXXXG 566 G GG GGGG G G G G G Sbjct: 83 GSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSG 117 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G GGG G GGG G GG GG G Sbjct: 79 GCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSG 127 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXG--GXXGGGGXGXGGG--XRGGXG 543 G G GGGG GGG GGG G GGG G G G GG G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGG 150 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGG--GXGXXGGGGXGXXXXXXGGXXG 545 G G G G G GGG G G GGGG G G G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGG G GG G G GGG G GGG G Sbjct: 230 GGGSSGGGGSGGSGCFSSG-GGGGSSGCGGGSSG 262 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GG G GG GG GG G Sbjct: 133 GGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSG 175 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGG GGG G GG G G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSS----GGGSGCFSSGGGGSSGGG 140 >M23263-1|AAA51775.1| 918|Homo sapiens androgen receptor protein. Length = 918 Score = 48.0 bits (109), Expect = 5e-05 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGGGGG GG GGGG G GGG GG G Sbjct: 442 GPCGGGGGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G GGGG G GGGGGG GG GGGG Sbjct: 442 GPCGGGGGGGGGGGGGGGGGGGGGGGGGG 470 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGGGG GG GGGG G GGG Sbjct: 442 GPCGGGGGGGGGGGGGGGGGGGGGGGGGG 470 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 GGG GGGG G GGGGGG GG GGGG Sbjct: 445 GGGGGGGGG----GGGGGGGGGGGGGGGGGG 471 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/36 (50%), Positives = 20/36 (55%) Frame = +1 Query: 382 KKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGG 489 ++G G GGG GGGG G GGGGGG GG Sbjct: 436 EEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G GG G G GGGGGG G GGGG G Sbjct: 445 GGGGGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXG 513 GGG G GGGGGG GG GGGG G Sbjct: 445 GGGGGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG 504 G GG GGGG G GGGGGG GG GGG Sbjct: 442 GPCGGGGGGGGGGGGGGGGGGGGGGGG--GGG 471 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G G G G GGGGGG G GGGG G Sbjct: 438 GQLYGPCGGGGGGGGGGGGGGGGGGGGGGGG 468 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG GG GGGG G GGG GG G Sbjct: 438 GQLYGPCGGGGGGGGGGGGGGGGGGGGGGG 467 Score = 36.3 bits (80), Expect = 0.15 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 446 GXRGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 G G GGGGGG GG GGGG GG Sbjct: 442 GPCGGGGGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 471 GGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GGGG G GGGG G GG G G Sbjct: 445 GGGGGGGGGGGGGGGGGGGGGGGGGGG 471 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG G GGGG G GG G G Sbjct: 438 GQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGGG 470 >L29496-1|AAA51770.1| 734|Homo sapiens AR protein. Length = 734 Score = 48.0 bits (109), Expect = 5e-05 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGGGGG GG GGGG G GGG GG G Sbjct: 258 GPCGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G GGGG G GGGGGG GG GGGG Sbjct: 258 GPCGGGGGGGGGGGGGGGGGGGGGGGGGG 286 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGGGG GG GGGG G GGG Sbjct: 258 GPCGGGGGGGGGGGGGGGGGGGGGGGGGG 286 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 GGG GGGG G GGGGGG GG GGGG Sbjct: 261 GGGGGGGGG----GGGGGGGGGGGGGGGGGG 287 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/36 (50%), Positives = 20/36 (55%) Frame = +1 Query: 382 KKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGG 489 ++G G GGG GGGG G GGGGGG GG Sbjct: 252 EEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G GG G G GGGGGG G GGGG G Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXG 513 GGG G GGGGGG GG GGGG G Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG 504 G GG GGGG G GGGGGG GG GGG Sbjct: 258 GPCGGGGGGGGGGGGGGGGGGGGGGGG--GGG 287 Score = 38.7 bits (86), Expect = 0.028 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G G G G GGGGGG G GGGG G Sbjct: 254 GQLYGPCGGGGGGGGGGGGGGGGGGGGGGGG 284 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GG GG GGGG G GGG GG G Sbjct: 254 GQLYGPCGGGGGGGGGGGGGGGGGGGGGGG 283 Score = 36.3 bits (80), Expect = 0.15 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 446 GXRGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 G G GGGGGG GG GGGG GG Sbjct: 258 GPCGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 471 GGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GGGG G GGGG G GG G G Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG G GGGG G GG G G Sbjct: 254 GQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGGG 286 >CR536555-1|CAG38792.1| 316|Homo sapiens LOR protein. Length = 316 Score = 48.0 bits (109), Expect = 5e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGG---GXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GGG G G GGG GG G Sbjct: 23 GGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGG 73 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG GG GG G GGG GG G Sbjct: 39 GGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCG 81 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GG G G GGGG G G G G GGG GG Sbjct: 22 GGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGG 62 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GG GG G Sbjct: 41 GSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSG 85 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGGG G GGG GG GGGG GG Sbjct: 63 GCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXR--GGXG 543 G G G GGGG G GG GGG GG GG G G GG + GG G Sbjct: 48 GSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGG 95 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GGGG GG GGG G GGG GG G Sbjct: 38 GGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGG--GGIG 78 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGG-GGXXXXXXXGGXXGXG 550 GGG GG G GGGGGG GG GG GG GG G G Sbjct: 55 GGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG G G GGG G GGG GG G Sbjct: 167 GGSSGGGSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GGGG G GGGG GGG G G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSG 266 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGGG GG GG GG GGG G G Sbjct: 56 GGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG GG G G GG G G G G G Sbjct: 23 GGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGG G GGG GG G GG G G G Sbjct: 173 GSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSGSG 211 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG--------GGGXGXGGGXRGGXG 543 GGG GG G G GG G GG G GGG GGG GG G Sbjct: 235 GGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGG 285 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GG G G GG G Sbjct: 76 GIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGG 120 Score = 36.7 bits (81), Expect = 0.11 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG------GGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G G GGGG GG G G GG GG G Sbjct: 92 GGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSG 142 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXXXXG 596 G G G GGGG G GGGG G G G G G G G G Sbjct: 22 GGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGG 72 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 469 GGGGXGGXXGGGGXG-XGGGXRGG 537 GGGG GG GGGG G GGG GG Sbjct: 21 GGGGGGGGSGGGGCGFFGGGGSGG 44 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXG-GGGXGXXXXXXGGXXGXG 551 G G G G GGGGG G G GGG G GG G Sbjct: 58 GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSG 98 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G G G GG G GGGG G GG G G G Sbjct: 262 GIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG GG GG G GG G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GG G G G GGG G GGG G Sbjct: 117 GGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G F G G G G G GGG GG GGGG G Sbjct: 32 GGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGG 501 G G G + G G G GGG GGGG GG G Sbjct: 72 GGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSS 131 Query: 502 GGXGXGGGXRG 534 GG G GG G Sbjct: 132 GGGGSSGGGSG 142 Score = 34.3 bits (75), Expect = 0.60 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 2/92 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G GG G G G G G G G G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCF 177 Query: 462 XGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 GGGGG G GGG G G G G Sbjct: 178 SSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGX---GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GGG G GGGG G GG G G Sbjct: 78 GGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGG 125 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG GG G GG G GG G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIG 264 Score = 33.1 bits (72), Expect = 1.4 Identities = 27/95 (28%), Positives = 29/95 (30%), Gaps = 3/95 (3%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXG-XGGXGXGXXXG 467 G GG + G + G G G GG G GG G G G Sbjct: 23 GGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Query: 468 GGGGGXGXXGGGG--XGXXXXXXGGXXGXGXXXXG 566 G GG GGGG G G G G G Sbjct: 83 GSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSG 117 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GGGG G G G G GGG G G Sbjct: 162 GGVSSGGSSGGGSGCFSSGGGG-GSVCGYSGGGSGGGSGCGGG 203 Score = 33.1 bits (72), Expect = 1.4 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXX---GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG GG G GG GG G Sbjct: 248 GGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGG--GGGGSSVGGSG 294 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRG 534 G GGG G G G GGG GG GG G G +G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G GGG G GGG G GG GG G Sbjct: 79 GCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSG 127 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXG--GXXGGGGXGXGGG--XRGGXG 543 G G GGGG GGG GGG G GGG G G G GG G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGG 150 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGG--GXGXXGGGGXGXXXXXXGGXXG 545 G G G G G GGG G G GGGG G G G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGG G GG G G GGG G GGG G Sbjct: 230 GGGSSGGGGSGGSGCFSSG-GGGGSSGCGGGSSG 262 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GG G GG GG GG G Sbjct: 133 GGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSG 175 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGG GGG G GG G G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSS----GGGSGCFSSGGGGSSGGG 140 >BC108290-1|AAI08291.1| 316|Homo sapiens LOR protein protein. Length = 316 Score = 48.0 bits (109), Expect = 5e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGG---GXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GGG G G GGG GG G Sbjct: 23 GGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGGG G GGGG G G G G GGG GG Sbjct: 22 GGGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGG 62 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG GG GG G GGG GG G Sbjct: 39 GGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCG 81 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GG GG G Sbjct: 41 GSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSG 85 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGGG G GGG GG GGGG GG Sbjct: 63 GCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXR--GGXG 543 G G G GGGG G GG GGG GG GG G G GG + GG G Sbjct: 48 GSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGG 95 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GGGG GG GGG G GGG GG G Sbjct: 38 GGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGG--GGIG 78 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGG-GGXXXXXXXGGXXGXG 550 GGG GG G GGGGGG GG GG GG GG G G Sbjct: 55 GGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG G G GGG G GGG GG G Sbjct: 167 GGSSGGGSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GGGG G GGGG GGG G G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSG 266 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGGG GG GG GG GGG G G Sbjct: 56 GGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG GG G G GG G G G G G Sbjct: 23 GGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGG G GGG GG G GG G G G Sbjct: 173 GSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSGSG 211 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXXXXG 596 G G GGGGGG G GGGG G G G G G G G G Sbjct: 22 GGGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGG 72 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG--------GGGXGXGGGXRGGXG 543 GGG GG G G GG G GG G GGG GGG GG G Sbjct: 235 GGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGG 285 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GG G G GG G Sbjct: 76 GIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGG 120 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG GGGG GG G G GG GG G Sbjct: 98 GGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSG 142 Score = 36.3 bits (80), Expect = 0.15 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGGGGG GG G G G GG G G Sbjct: 21 GGGGGGGGGGGGGCGFFGGGGSGGGSSGSG 50 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXG-GGGXGXXXXXXGGXXGXG 551 G G G G GGGGG G G GGG G GG G Sbjct: 58 GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSG 98 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G G G GG G GGGG G GG G G G Sbjct: 262 GIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG GG GG G GG G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GG G G G GGG G GGG G Sbjct: 117 GGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G F G G G G G GGG GG GGGG G Sbjct: 32 GGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGG 501 G G G + G G G GGG GGGG GG G Sbjct: 72 GGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSS 131 Query: 502 GGXGXGGGXRG 534 GG G GG G Sbjct: 132 GGGGSSGGGSG 142 Score = 34.3 bits (75), Expect = 0.60 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 2/92 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G GG G G G G G G G G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCF 177 Query: 462 XGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 GGGGG G GGG G G G G Sbjct: 178 SSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGX---GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GGG G GGGG G GG G G Sbjct: 78 GGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGG 125 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG GG G GG G GG G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIG 264 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GGGG G G G G GGG G G Sbjct: 162 GGVSSGGSSGGGSGCFSSGGGG-GSVCGYSGGGSGGGSGCGGG 203 Score = 33.1 bits (72), Expect = 1.4 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXX---GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG GG G GG GG G Sbjct: 248 GGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGG--GGGGSSVGGSG 294 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRG 534 G GGG G G G GGG GG GG G G +G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 32.7 bits (71), Expect = 1.8 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 3/95 (3%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXG-XGGXGXGXXXG 467 G GG G + G G G GG G GG G G G Sbjct: 23 GGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Query: 468 GGGGGXGXXGGGG--XGXXXXXXGGXXGXGXXXXG 566 G GG GGGG G G G G G Sbjct: 83 GSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSG 117 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G GGG G GGG G GG GG G Sbjct: 79 GCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSG 127 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXG--GXXGGGGXGXGGG--XRGGXG 543 G G GGGG GGG GGG G GGG G G G GG G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGG 150 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGG--GXGXXGGGGXGXXXXXXGGXXG 545 G G G G G GGG G G GGGG G G G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGG G GG G G GGG G GGG G Sbjct: 230 GGGSSGGGGSGGSGCFSSG-GGGGSSGCGGGSSG 262 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GG G GG GG GG G Sbjct: 133 GGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSG 175 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGG GGG G GG G G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSS----GGGSGCFSSGGGGSSGGG 140 >BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 48.0 bits (109), Expect = 5e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PPPP P PPPPP PPP PPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDF---MEPPPDFVPPPPP 588 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP---PPPPPXXPXXXXP--PPPXXPPPXP 408 P PPL P P PPP P P PPPPP PPP PPP P Sbjct: 559 PPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAP 608 Score = 44.0 bits (99), Expect = 7e-04 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXP 333 P PP PP PPPPP P PPP PP P ++ P P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPP 606 Query: 332 XP 327 P Sbjct: 607 AP 608 Score = 38.7 bits (86), Expect = 0.028 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 10/62 (16%) Frame = -1 Query: 542 PXPPLXPPPXP---------XPPPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXPXXXXK 393 P P PPP P PPPP PP P P P P PPP PP P + Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPP--PPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQE 635 Query: 392 XP 387 P Sbjct: 636 NP 637 Score = 36.7 bits (81), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPP P P PP Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPX-XPPXP---PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP P P PPPPP P PPP Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPP 604 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPP-----PXXPXPPPPPPXXXPXPXPPXP 431 P P P P P P PPP PPPPPP P P P Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPD 615 Query: 430 XXXPP 416 PP Sbjct: 616 SARPP 620 Score = 33.9 bits (74), Expect = 0.80 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 12/61 (19%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPP---------XXXPXPXPPXPXXX 422 P P P PP PPPP PPP PPP P P PP P Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPA 609 Query: 421 P 419 P Sbjct: 610 P 610 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP P P P P PPP PP P P Sbjct: 599 PPPPPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHP 640 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPPP P P P P PP PP+ Sbjct: 579 PPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPV 629 >BC034690-1|AAH34690.1| 316|Homo sapiens LOR protein protein. Length = 316 Score = 48.0 bits (109), Expect = 5e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGG---GXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GGG G G GGG GG G Sbjct: 23 GGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGG 73 Score = 47.6 bits (108), Expect = 6e-05 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGGG G GGGG G G G G GGG GG Sbjct: 22 GGGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGG 62 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG GG GG G GGG GG G Sbjct: 39 GGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCG 81 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GG GG G Sbjct: 41 GSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSG 85 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGGG G GGG GG GGGG GG Sbjct: 63 GCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXR--GGXG 543 G G G GGGG G GG GGG GG GG G G GG + GG G Sbjct: 48 GSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGG 95 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GGGG GG GGG G GGG GG G Sbjct: 38 GGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGG--GGIG 78 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGG-GGXXXXXXXGGXXGXG 550 GGG GG G GGGGGG GG GG GG GG G G Sbjct: 55 GGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG G G GGG G GGG GG G Sbjct: 167 GGSSGGGSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GGGG G GGGG GGG G G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSG 266 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGGG GG GG GG GGG G G Sbjct: 56 GGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG GG G G GG G G G G G Sbjct: 23 GGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGG G GGG GG G GG G G G Sbjct: 173 GSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSGSG 211 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXXXXG 596 G G GGGGGG G GGGG G G G G G G G G Sbjct: 22 GGGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGG 72 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG--------GGGXGXGGGXRGGXG 543 GGG GG G G GG G GG G GGG GGG GG G Sbjct: 235 GGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGG 285 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GG G G GG G Sbjct: 76 GIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGG 120 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG GGGG GG G G GG GG G Sbjct: 98 GGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSG 142 Score = 36.3 bits (80), Expect = 0.15 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGGGGG GG G G G GG G G Sbjct: 21 GGGGGGGGGGGGGCGFFGGGGSGGGSSGSG 50 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXG-GGGXGXXXXXXGGXXGXG 551 G G G G GGGGG G G GGG G GG G Sbjct: 58 GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSG 98 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G G G GG G GGGG G GG G G G Sbjct: 262 GIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG GG GG G GG G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GG G G G GGG G GGG G Sbjct: 117 GGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G F G G G G G GGG GG GGGG G Sbjct: 32 GGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGG 501 G G G + G G G GGG GGGG GG G Sbjct: 72 GGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSS 131 Query: 502 GGXGXGGGXRG 534 GG G GG G Sbjct: 132 GGGGSSGGGSG 142 Score = 34.3 bits (75), Expect = 0.60 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 2/92 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G GG G G G G G G G G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCF 177 Query: 462 XGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 GGGGG G GGG G G G G Sbjct: 178 SSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGX---GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GGG G GGGG G GG G G Sbjct: 78 GGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGG 125 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG GG G GG G GG G G Sbjct: 230 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIG 264 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GGGG G G G G GGG G G Sbjct: 162 GGVSSGGSSGGGSGCFSSGGGG-GSVCGYSGGGSGGGSGCGGG 203 Score = 33.1 bits (72), Expect = 1.4 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXX---GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG GG G GG GG G Sbjct: 248 GGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGG--GGGGSSVGGSG 294 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRG 534 G GGG G G G GGG GG GG G G +G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 32.7 bits (71), Expect = 1.8 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 3/95 (3%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXG-XGGXGXGXXXG 467 G GG G + G G G GG G GG G G G Sbjct: 23 GGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Query: 468 GGGGGXGXXGGGG--XGXXXXXXGGXXGXGXXXXG 566 G GG GGGG G G G G G Sbjct: 83 GSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSG 117 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G GGG G GGG G GG GG G Sbjct: 79 GCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSG 127 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXG--GXXGGGGXGXGGG--XRGGXG 543 G G GGGG GGG GGG G GGG G G G GG G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGG 150 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGG--GXGXXGGGGXGXXXXXXGGXXG 545 G G G G G GGG G G GGGG G G G Sbjct: 255 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 298 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGG G GG G G GGG G GGG G Sbjct: 230 GGGSSGGGGSGGSGCFSSG-GGGGSSGCGGGSSG 262 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GG G GG GG GG G Sbjct: 133 GGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSG 175 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGG GGG G GG G G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSS----GGGSGCFSSGGGGSSGGG 140 >AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adaptor molecule protein. Length = 665 Score = 48.0 bits (109), Expect = 5e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PPPP P PPPPP PPP PPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDF---MEPPPDFVPPPPP 588 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP---PPPPPXXPXXXX---PPPPXXPPPXP 408 P PPL P P PPP P P PPPPP PPPP P P P Sbjct: 559 PPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPAPAP 609 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPP--LXPPPXPXPPPPXX------PPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP + PPP PPPP PPPPPP P P PPP Sbjct: 570 PPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPAPAPAPVPDSARPPP 620 Score = 36.7 bits (81), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPP P P PP Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPX-XPPXP---PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP P P PPPPP P PPP Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPP 604 Score = 35.9 bits (79), Expect = 0.20 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 9/61 (14%) Frame = -1 Query: 542 PXPPLXPPPXPX---------PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKX 390 P P PPP P PPPP PP P P P PP PP P + Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPP--PPPAPAPAPVPDSARPPPAVAKRPPVPPKRQEN 635 Query: 389 P 387 P Sbjct: 636 P 636 Score = 33.1 bits (72), Expect = 1.4 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 13/62 (20%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPP----------XXXPXPXPPXPXX 425 P P P PP PPPP PPP PPP P P PP P Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPAPAP 609 Query: 424 XP 419 P Sbjct: 610 AP 611 Score = 33.1 bits (72), Expect = 1.4 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 4/64 (6%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXP----PPPPPXXXPXPXPPXPX 428 P P P P P P PPP PPPPP P P P Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPAPAPAPVPDS 615 Query: 427 XXPP 416 PP Sbjct: 616 ARPP 619 Score = 32.7 bits (71), Expect = 1.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PPPP P P P P P P PP Sbjct: 586 PPPSYAGIAGSELPPPPPPPAPAPAPVPDSARPPPAVAKRPPVPP 630 Score = 32.3 bits (70), Expect = 2.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P P P P PPP PP P P Sbjct: 599 PP--PPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHP 639 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPPP P P P P P PP PP+ Sbjct: 579 PPDFVPPPPPSYAGIAGSELPPPPPPPAPAPAPVPDSARP-PPAVAKRPPV 628 >AL161636-5|CAI19560.1| 312|Homo sapiens loricrin protein. Length = 312 Score = 48.0 bits (109), Expect = 5e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGG---GXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GGG G G GGG GG G Sbjct: 23 GGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGG 73 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG GG GG G GGG GG G Sbjct: 39 GGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCG 81 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GG G G GGGG G G G G GGG GG Sbjct: 22 GGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGG 62 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GG GG G Sbjct: 41 GSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSG 85 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGGG G GGG GG GGGG GG Sbjct: 63 GCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXR--GGXG 543 G G G GGGG G GG GGG GG GG G G GG + GG G Sbjct: 48 GSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGG 95 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GGGG GG GGG G GGG GG G Sbjct: 38 GGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGG--GGIG 78 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG GG G G GGGGGG G GGG G GG G Sbjct: 55 GGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGG 99 Score = 42.3 bits (95), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GGG GGGG G GGGG GGG G G G Sbjct: 226 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSG 262 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGGG GG GG GG GGG G G Sbjct: 56 GGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG GG G G GG G G G G G Sbjct: 23 GGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG GGGG G GGG G GGG GG G Sbjct: 163 GVSSGGSSGGGSGCFSSGGGGGSVCG--YSGGGSGCGGGSSGGSG 205 Score = 38.3 bits (85), Expect = 0.037 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG--------GGGXGXGGGXRGGXG 543 GGG GG G G GG G GG G GGG GGG GG G Sbjct: 231 GGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGG 281 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GG G G GG G Sbjct: 76 GIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGG 120 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG GGGG GG G G GG GG G Sbjct: 98 GGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSG 142 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXXXXG 596 G G G GGGG G GGGG G G G G G G G G Sbjct: 22 GGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGG 72 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG 513 G G GGGG G GGG G GG GG G G Sbjct: 173 GSGCFSSGGGGGSVCGYSGGGSGCGGGSSGGSGSG 207 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 469 GGGGXGGXXGGGGXG-XGGGXRGG 537 GGGG GG GGGG G GGG GG Sbjct: 21 GGGGGGGGSGGGGCGFFGGGGSGG 44 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G G G GG G GGGG G GG G G G Sbjct: 258 GIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 294 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG GG GG G GG G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GG G G G GGG G GGG G Sbjct: 117 GGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G F G G G G G GGG GG GGGG G Sbjct: 32 GGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGG 501 G G G + G G G GGG GGGG GG G Sbjct: 72 GGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSS 131 Query: 502 GGXGXGGGXRG 534 GG G GG G Sbjct: 132 GGGGSSGGGSG 142 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGX---GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GGG G GGGG G GG G G Sbjct: 78 GGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGG 125 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 447 GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G GGG GG G GG G GG G G Sbjct: 226 GGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIG 260 Score = 33.1 bits (72), Expect = 1.4 Identities = 27/95 (28%), Positives = 29/95 (30%), Gaps = 3/95 (3%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXG-XGGXGXGXXXG 467 G GG + G + G G G GG G GG G G G Sbjct: 23 GGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Query: 468 GGGGGXGXXGGGG--XGXXXXXXGGXXGXGXXXXG 566 G GG GGGG G G G G G Sbjct: 83 GSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSG 117 Score = 33.1 bits (72), Expect = 1.4 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXR--GGXG 543 G GGG G GG G G G GGG G GGG GG G Sbjct: 244 GGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSG 290 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRG 534 G GGG G G G GGG GG GG G G +G Sbjct: 251 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 294 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G GGG G GGG G GG GG G Sbjct: 79 GCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSG 127 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXG--GXXGGGGXGXGGG--XRGGXG 543 G G GGGG GGG GGG G GGG G G G GG G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGG 150 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGG--GXGXXGGGGXGXXXXXXGGXXG 545 G G G G G GGG G G GGGG G G G Sbjct: 251 GCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKG 294 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 433 GGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GGG G GG G G GGG G GGG G Sbjct: 226 GGGSSGGGGSGGSGCFSSG-GGGGSSGCGGGSSG 258 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GG G GG GG GG G Sbjct: 133 GGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSG 175 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGG GGG G GG G G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSS----GGGSGCFSSGGGGSSGGG 140 Score = 30.3 bits (65), Expect = 9.8 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 1/86 (1%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G GG G G G G G G G G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCF 177 Query: 462 X-GGGGGGXGXXGGGGXGXXXXXXGG 536 GGGGG GGG G GG Sbjct: 178 SSGGGGGSVCGYSGGGSGCGGGSSGG 203 >AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 48.0 bits (109), Expect = 5e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PPPP P PPPPP PPP PPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDF---MEPPPDFVPPPPP 588 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP---PPPPPXXPXXXXP--PPPXXPPPXP 408 P PPL P P PPP P P PPPPP PPP PPP P Sbjct: 559 PPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAP 608 Score = 44.0 bits (99), Expect = 7e-04 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXP 333 P PP PP PPPPP P PPP PP P ++ P P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPP 606 Query: 332 XP 327 P Sbjct: 607 AP 608 Score = 38.7 bits (86), Expect = 0.028 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 10/62 (16%) Frame = -1 Query: 542 PXPPLXPPPXP---------XPPPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXPXXXXK 393 P P PPP P PPPP PP P P P P PPP PP P + Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPP--PPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQE 635 Query: 392 XP 387 P Sbjct: 636 NP 637 Score = 36.7 bits (81), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPP P P PP Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPX-XPPXP---PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP P P PPPPP P PPP Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPP 604 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPP-----PXXPXPPPPPPXXXPXPXPPXP 431 P P P P P P PPP PPPPPP P P P Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPD 615 Query: 430 XXXPP 416 PP Sbjct: 616 SARPP 620 Score = 33.9 bits (74), Expect = 0.80 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 12/61 (19%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPP---------XXXPXPXPPXPXXX 422 P P P PP PPPP PPP PPP P P PP P Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPA 609 Query: 421 P 419 P Sbjct: 610 P 610 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP P P P P PPP PP P P Sbjct: 599 PPPPPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHP 640 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPPP P P P P PP PP+ Sbjct: 579 PPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPV 629 >AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. Length = 854 Score = 48.0 bits (109), Expect = 5e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPPP PP PPPP P PPPP P P P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLP----PPPPGYPAPKP 460 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPPP P PPPPP P P P P PP+ Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPPV 462 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PP P PPPP PPPP P P PP P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPP----PGYPAPKPPVGP 464 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP P PPPP PPPPP P P PP Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPPP--GYPAPKPP 461 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPPPP P PP PPP P P Sbjct: 416 PELGLPRGTIGKPTPPPPPPSFPPPPPPPGTQLPPPPPGYPAPKP 460 Score = 38.3 bits (85), Expect = 0.037 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPPPPP P PPP P P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 Score = 35.5 bits (78), Expect = 0.26 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PPPPPP P P P P P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 Score = 35.1 bits (77), Expect = 0.34 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXP 431 PPPP P PP P P P PP P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 Score = 34.3 bits (75), Expect = 0.60 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 530 LXPPPXPXPPP-PXXPPXPPPPPP 462 L PPP P PPP P PPP PP Sbjct: 595 LPPPPPPPPPPLPEAASSPPPAPP 618 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXP 453 PP P PPPP P PPP P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPP 618 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P PP P PP P PPP P P P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPPVGP 464 Score = 31.5 bits (68), Expect = 4.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP 465 PP PPP P P PP PP P Sbjct: 597 PPPPPPPPPLPEAASSPPPAPPLP 620 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 5/31 (16%) Frame = -1 Query: 512 PXPPPPXXPPXP-----PPPPPXXPXXXXPP 435 P PPPP PP P PPP P P P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLPLESAGP 626 Score = 30.7 bits (66), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPP 429 PPP PP PPPP P P PP Sbjct: 596 PPP--PPPPPPPLPEAASSPPPAPP 618 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 PP PPP P P P P PP P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 >AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein protein. Length = 671 Score = 48.0 bits (109), Expect = 5e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPPP PP PPPP P PPPP P P P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLP----PPPPSYPSPKP 362 Score = 46.0 bits (104), Expect = 2e-04 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPPP P PPPPP P P P P PP+ Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPPPPSYPSPKPPV 364 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PP P PPPP PPPP P P PP P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPP----PSYPSPKPPVGP 366 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP P PPPP PPPPP P P PP Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPPP--SYPSPKPP 363 Score = 38.7 bits (86), Expect = 0.028 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPPPPP P PP PPP P P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPPPSYPSPKP 362 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPP 462 PPP P PP P PPP PP Sbjct: 469 PPPPPPPPLPEAASSPPPVPP 489 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPP 414 PPPPPP P PPP P P Sbjct: 470 PPPPPPPLPEAASSPPPVPPLP 491 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P PP P PP P PPP P P P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPPPSYPSPKPPVGP 366 Score = 30.7 bits (66), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXP 431 PPPP P PP P P P PP P Sbjct: 469 PPPP--PPPPLPEAASSPPPVPPLP 491 Score = 30.3 bits (65), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 480 PPPPPPXXPRXPXPPXPXXPPP 415 PPPPPP P P P P P Sbjct: 470 PPPPPPPLPEAASSPPPVPPLP 491 >AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. Length = 854 Score = 48.0 bits (109), Expect = 5e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPPP PP PPPP P PPPP P P P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLP----PPPPGYPAPKP 460 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPPP P PPPPP P P P P PP+ Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPPV 462 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PP P PPPP PPPP P P PP P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPP----PGYPAPKPPVGP 464 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP P PPPP PPPPP P P PP Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPPP--GYPAPKPP 461 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P PPPPPP P PP PPP P P Sbjct: 416 PELGLPRGTIGKPTPPPPPPSFPPPPPPPGTQLPPPPPGYPAPKP 460 Score = 38.3 bits (85), Expect = 0.037 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPPPPP P PPP P P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 Score = 35.5 bits (78), Expect = 0.26 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXPPP 415 PP PPPPPP P P P P P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 Score = 35.1 bits (77), Expect = 0.34 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXP 431 PPPP P PP P P P PP P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 Score = 34.3 bits (75), Expect = 0.60 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 530 LXPPPXPXPPP-PXXPPXPPPPPP 462 L PPP P PPP P PPP PP Sbjct: 595 LPPPPPPPPPPLPEAASSPPPAPP 618 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXP 453 PP P PPPP P PPP P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPP 618 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P PP P PP P PPP P P P Sbjct: 428 PTPPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPPVGP 464 Score = 31.5 bits (68), Expect = 4.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP 465 PP PPP P P PP PP P Sbjct: 597 PPPPPPPPPLPEAASSPPPAPPLP 620 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 5/31 (16%) Frame = -1 Query: 512 PXPPPPXXPPXP-----PPPPPXXPXXXXPP 435 P PPPP PP P PPP P P P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLPLESAGP 626 Score = 30.7 bits (66), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPP 429 PPP PP PPPP P P PP Sbjct: 596 PPP--PPPPPPPLPEAASSPPPAPP 618 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPP 462 PP PPP P P P P PP P Sbjct: 596 PPPPPPPPPPLPEAASSPPPAPPLP 620 >AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. Length = 671 Score = 48.0 bits (109), Expect = 5e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PPPP PP PPPP P PPPP P P P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLP----PPPPSYPSPKP 362 Score = 46.0 bits (104), Expect = 2e-04 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPPP P PPPPP P P P P PP+ Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPPPPSYPSPKPPV 364 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P PP PP P PPPP PPPP P P PP P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPP----PSYPSPKPPVGP 366 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P PP P PPPP PPPPP P P PP Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPPP--SYPSPKPP 363 Score = 38.7 bits (86), Expect = 0.028 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 485 PXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPPPPP P PP PPP P P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPPPSYPSPKP 362 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPP 462 PPP P PP P PPP PP Sbjct: 469 PPPPPPPPLPEAASSPPPVPP 489 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPP 414 PPPPPP P PPP P P Sbjct: 470 PPPPPPPLPEAASSPPPVPPLP 491 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXP 440 P P PP P PP P PPP P P P Sbjct: 330 PIPPPPPPSFPPPPPPPGTQLPPPPPSYPSPKPPVGP 366 Score = 30.7 bits (66), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXP 431 PPPP P PP P P P PP P Sbjct: 469 PPPP--PPPPLPEAASSPPPVPPLP 491 Score = 30.3 bits (65), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 480 PPPPPPXXPRXPXPPXPXXPPP 415 PPPPPP P P P P P Sbjct: 470 PPPPPPPLPEAASSPPPVPPLP 491 >AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73 protein. Length = 666 Score = 48.0 bits (109), Expect = 5e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PPPP P PPPPP PPP PPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDF---MEPPPDFVPPPPP 588 Score = 47.6 bits (108), Expect = 6e-05 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP---PPPPPXXPXXXXP--PPPXXPPPXP 408 P PPL P P PPP P P PPPPP PPP PPP P Sbjct: 559 PPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAP 608 Score = 44.0 bits (99), Expect = 7e-04 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXPXXXXXXP 333 P PP PP PPPPP P PPP PP P ++ P P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPP 606 Query: 332 XP 327 P Sbjct: 607 AP 608 Score = 38.7 bits (86), Expect = 0.028 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 10/62 (16%) Frame = -1 Query: 542 PXPPLXPPPXP---------XPPPPXXPPXPPPPPPXXPXXXXPPPPXXP-PPXPXXXXK 393 P P PPP P PPPP PP P P P P PPP PP P + Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPP--PPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQE 635 Query: 392 XP 387 P Sbjct: 636 NP 637 Score = 36.7 bits (81), Expect = 0.11 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P P PPPP P PPPPP P P PP Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPX-XPPXP---PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP P P PPPPP P PPP Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPP 604 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPP-----PXXPXPPPPPPXXXPXPXPPXP 431 P P P P P P PPP PPPPPP P P P Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPD 615 Query: 430 XXXPP 416 PP Sbjct: 616 SARPP 620 Score = 33.9 bits (74), Expect = 0.80 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 12/61 (19%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPP---------XXXPXPXPPXPXXX 422 P P P PP PPPP PPP PPP P P PP P Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPA 609 Query: 421 P 419 P Sbjct: 610 P 610 Score = 33.1 bits (72), Expect = 1.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP P P P P PPP PP P P Sbjct: 599 PPPPPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHP 640 Score = 31.1 bits (67), Expect = 5.6 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P P PPPP P P P P PP PP+ Sbjct: 579 PPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPV 629 >AB013076-1|BAA25794.1| 338|Homo sapiens loricrin protein. Length = 338 Score = 48.0 bits (109), Expect = 5e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG---GXXGGG---GXGXGGGXRGGXG 543 G GGG GGGG G G GGG G G GGG G G GGG GG G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGG 73 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G GGGG GG GG G GGG GG G Sbjct: 39 GGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCG 81 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG GG GGGG G GG GG G Sbjct: 41 GSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSG 85 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGGG G GGG GG GGGG GG Sbjct: 63 GCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/48 (50%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXR--GGXG 543 G G G GGGG G GG GGG GG GG G G GG + GG G Sbjct: 48 GSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGG 95 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GGGG GG GGG G GGG GG G Sbjct: 38 GGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGG--GGIG 78 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGG-GGXXXXXXXGGXXGXG 550 GGG GG G GGGGGG GG GG GG GG G G Sbjct: 55 GGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 43.6 bits (98), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GG G G GGG G GGG GG G Sbjct: 167 GGSSGGGSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 41.9 bits (94), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGGG GG GG GG GGG G G Sbjct: 56 GGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGG 100 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXG--XGGGXRGG 537 GG GGGG G GGGG GG G G G GGG GG Sbjct: 21 GGGGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGG 62 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G GGG GG G G GG G G G G G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G G GGGG G GGG GG G GG G G G Sbjct: 173 GSGCFSSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSGSG 211 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GG GG G GG G G GG G Sbjct: 76 GIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGG 120 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG GGGG GG G G GG GG G Sbjct: 98 GGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSG 142 Score = 35.5 bits (78), Expect = 0.26 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXGXXXXXG 596 GG G G G GGGG G GGGG G G G G G G G G Sbjct: 21 GGGGGG--GGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGG 72 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXG-GGGXGXXXXXXGGXXGXG 551 G G G G GGGGG G G GGG G GG G Sbjct: 58 GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSG 98 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG GG GG G GG G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GG GG G G G GGG G GGG G Sbjct: 117 GGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSG 153 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G F G G G G G GGG GG GGGG G Sbjct: 32 GGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGG 501 G G G + G G G GGG GGGG GG G Sbjct: 72 GGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSS 131 Query: 502 GGXGXGGGXRG 534 GG G GG G Sbjct: 132 GGGGSSGGGSG 142 Score = 34.3 bits (75), Expect = 0.60 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 2/92 (2%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G GG G G G G G G G G G Sbjct: 118 GGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCF 177 Query: 462 XGGGGGG--XGXXGGGGXGXXXXXXGGXXGXG 551 GGGGG G GGG G G G G Sbjct: 178 SSGGGGGSVCGYSGGGSGGGSGCGGGSSGGSG 209 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGX---GXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GGG G GGGG G GG G G Sbjct: 78 GGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGG 125 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G GGGG G G G G GGG G G Sbjct: 162 GGVSSGGSSGGGSGCFSSGGGG-GSVCGYSGGGSGGGSGCGGG 203 Score = 32.7 bits (71), Expect = 1.8 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 3/95 (3%) Frame = +3 Query: 291 GXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXG-XGGXGXGXXXG 467 G GG G + G G G GG G GG G G G Sbjct: 23 GGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGG 82 Query: 468 GGGGGXGXXGGGG--XGXXXXXXGGXXGXGXXXXG 566 G GG GGGG G G G G G Sbjct: 83 GSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSG 117 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG----GXGXGGGXRGGXG 543 G GGG G G GGG G GGG G GG GG G Sbjct: 79 GCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSG 127 Score = 32.3 bits (70), Expect = 2.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXG--GXXGGGGXGXGGG--XRGGXG 543 G G GGGG GGG GGG G GGG G G G GG G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGG 150 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG GG G GG GG GG G Sbjct: 133 GGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSG 175 Score = 30.3 bits (65), Expect = 9.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GGGG GGG G GG G G Sbjct: 100 GSGCFSSGGGGSGCFSSGGGGSS----GGGSGCFSSGGGGSSGGG 140 >Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. Length = 638 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 40.3 bits (90), Expect = 0.009 Identities = 18/36 (50%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 536 PPLXP-PPXPXPP-PPXXPPXPPPPPPXXPXXXXPP 435 P + P PP PP PP PP PPPPPP PP Sbjct: 564 PTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMIPP 599 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P P P PP PP PPPPPP PP P PL Sbjct: 564 PTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPL 616 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect = 7.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 >X86019-1|CAA60014.1| 494|Homo sapiens SH3-domain interacting protein protein. Length = 494 Score = 47.6 bits (108), Expect = 6e-05 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GGG GGGG G GGGGGG GG GGGG G GG + G Sbjct: 68 GGGGGGFGGGG----GFGGGGGGGGGGSFGGGGPPGLGGLFQAG 107 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 350 KXXKXKKXXXKKRGVXXXXXXXGGGXXGXGGX--GXRGXXGGGGGGXGGXXGGGG 508 K K KK R G G G GG G G GGGGGG GG GGGG Sbjct: 42 KGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGG 96 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GGGG G GG GGGG GGG G G Sbjct: 64 GAGAGGGGG----GFGGGGGFGGGGGGGGGGSFGGGGPPGLGG 102 Score = 38.3 bits (85), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 PPL P P PP P PPPP P P P PP Sbjct: 346 PPLPSPGRSGPLPPPVPSERPPPPVRDPPGRSGPLPPPPP 385 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P P P P P P P PPPP P P P Sbjct: 283 PPPPPQNNKPPVPSTPRPSAPHRPHL-RPPPPSRPGPPP 320 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GGGGGG G GG G G G G G G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLG 101 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P PPP PP P PPPPP Sbjct: 360 PVPSERPPPPVRDPPGRSGPLPPPPP 385 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXP 420 P P PP P P P P P PPPP P PPP P Sbjct: 285 PPPQNNKPPVPSTPRPSAPHRPHLRPPPPSRPG----PPPLPP 323 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-----PPPPXXPPPXP 408 PPL PP P PP PPPP P PPP PP P Sbjct: 250 PPL--PPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 Score = 31.9 bits (69), Expect = 3.2 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 4/74 (5%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXP----PXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPX 427 P P P P P P PPPP P PP P PR P P Sbjct: 250 PPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPP--PQNNKPPVPSTPRPSAPHRPH 307 Query: 426 XPPPXXXXXXXTPL 385 PP PL Sbjct: 308 LRPPPPSRPGPPPL 321 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 PP PP P P P P P P P P P PP TP Sbjct: 283 PPPPPQNNKPPVPSTPRPSAPHRPHLRPPPPSRPGPPPLPPSSSGNDETP 332 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +G GGGGG G GG G GG G G Sbjct: 63 KGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 >D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. Length = 623 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect = 7.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 >D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternatively spliced product protein. Length = 548 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect(2) = 0.028 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 Score = 27.1 bits (57), Expect(2) = 0.028 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P + PPP P P P PPP Sbjct: 421 PPPWMQPPPPPMNQGPHPPGHHGPPP 446 >BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein protein. Length = 510 Score = 47.6 bits (108), Expect = 6e-05 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GGG GGGG G GGGGGG GG GGGG G GG + G Sbjct: 68 GGGGGGFGGGG----GFGGGGGGGGGGSFGGGGPPGLGGLFQAG 107 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 350 KXXKXKKXXXKKRGVXXXXXXXGGGXXGXGGX--GXRGXXGGGGGGXGGXXGGGG 508 K K KK R G G G GG G G GGGGGG GG GGGG Sbjct: 42 KGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGG 96 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GGGG G GG GGGG GGG G G Sbjct: 64 GAGAGGGGG----GFGGGGGFGGGGGGGGGGSFGGGGPPGLGG 102 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPL P P PP PPPP P P PP PPP Sbjct: 346 PPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPP--PPP 384 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P P PP P P P PPPPP P PPP P Sbjct: 285 PPPQNNKPPVPSTPRPSASSQAPPPPP--PPSRPGPPPLPP 323 Score = 33.9 bits (74), Expect = 0.80 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P P PPPP P P Sbjct: 284 PPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGP 318 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GGGGGG G GG G G G G G G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLG 101 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPX----PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPPP PP P P PP PPP Sbjct: 267 PPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPP 313 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PPPP P PPP PP Sbjct: 295 PSTPRPSASSQAPPPPPPPSRPGPPPLPP 323 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-----PPPPXXPPPXP 408 PPL PP P PP PPPP P PPP PP P Sbjct: 250 PPL--PPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P PPPP P PP P P PP P Sbjct: 346 PPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPP 383 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPPP 432 PP PPP PP P P PPPP P PPP Sbjct: 283 PP--PPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPP 320 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +G GGGGG G GG G GG G G Sbjct: 63 KGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 >BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. Length = 403 Score = 47.6 bits (108), Expect = 6e-05 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GGG GGGG G GGGGGG GG GGGG G GG + G Sbjct: 68 GGGGGGFGGGG----GFGGGGGGGGGGSFGGGGPPGLGGLFQAG 107 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 350 KXXKXKKXXXKKRGVXXXXXXXGGGXXGXGGX--GXRGXXGGGGGGXGGXXGGGG 508 K K KK R G G G GG G G GGGGGG GG GGGG Sbjct: 42 KGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGG 96 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GGGG G GG GGGG GGG G G Sbjct: 64 GAGAGGGGG----GFGGGGGFGGGGGGGGGGSFGGGGPPGLGG 102 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P P PP P P P PPPPP P PPP P Sbjct: 285 PPPQNNKPPVPSTPRPSASSQAPPPPP--PPSRPGPPPLPP 323 Score = 33.9 bits (74), Expect = 0.80 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P P PPPP P P Sbjct: 284 PPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGP 318 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GGGGGG G GG G G G G G G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLG 101 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPX----PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPPP PP P P PP PPP Sbjct: 267 PPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPP 313 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PPPP P PPP PP Sbjct: 295 PSTPRPSASSQAPPPPPPPSRPGPPPLPP 323 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-----PPPPXXPPPXP 408 PPL PP P PP PPPP P PPP PP P Sbjct: 250 PPL--PPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPPP 432 PP PPP PP P P PPPP P PPP Sbjct: 283 PP--PPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPP 320 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +G GGGGG G GG G GG G G Sbjct: 63 KGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 >BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect(2) = 0.028 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 Score = 27.1 bits (57), Expect(2) = 0.028 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P + PPP P P P PPP Sbjct: 421 PPPWMQPPPPPMNQGPHPPGHHGPPP 446 >BC015180-1|AAH15180.1| 443|Homo sapiens homeobox A3 protein. Length = 443 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPL PPP PP PP P P PP PPP PP Sbjct: 88 PPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPP 128 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPX-XPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 P PP PP P PP P PP P P P P PP P P K P + Sbjct: 92 PPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPPQNASNNPTPANAAKSPLLN 147 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PP PPPP P P PP P P P P PP Sbjct: 79 PSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPP 121 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PPPP P P PP P P P PPP Sbjct: 82 PPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPP 122 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP PPPP P PP P PP P P Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPP 121 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP PP PP P P P P P PP P Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPP 122 Score = 38.3 bits (85), Expect = 0.037 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP P P PP P+ P P PPP Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPP 122 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXP 431 P P P PP P P PP P PP P P P P P Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASP 127 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP-XXPPPXXXXXXXTP 388 P PP PP P P P P P PP P PP TP Sbjct: 83 PSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPPQNASNNPTP 137 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PPP PP P P P PPPP Sbjct: 288 PYEPQSPPPFSKPPQGTYGLPPASYPASLPSCAPPPPP 325 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXP-XPPPPPPXXXPXPXPPXPXXXPP 416 P P PP PP P P P PP P PP PP Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPP 128 >BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect(2) = 0.028 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 Score = 27.1 bits (57), Expect(2) = 0.028 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P + PPP P P P PPP Sbjct: 421 PPPWMQPPPPPMNQGPHPPGHHGPPP 446 >BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 47.6 bits (108), Expect = 6e-05 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 P PP+ P P PPP PP PP P PP PPPP PPP Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPP 513 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PPPP P PPPPP P PPP P Sbjct: 471 PP--PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPP 511 Score = 38.7 bits (86), Expect = 0.028 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 534 PPXXXXXXXPPPPXX-PPXPP--PPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 PP PPPP PP PP P PP + PP P PPP TPL Sbjct: 473 PPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP--PPPSSSMASSTPL 523 Score = 35.1 bits (77), Expect = 0.34 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 498 PXXPPXP--PPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP P PPPP + P PP PPP TP+ Sbjct: 417 PNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPV 456 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 10/46 (21%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP----------PPPPPXXPXXXXPPPP 429 PP PPP PPPP P P PPPPP P P Sbjct: 479 PPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLP 524 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P PPP P PPPP P PP PP+ Sbjct: 417 PNGPPP--PWMQPPPPPMNQGPHPPGHHGPPPM 447 Score = 30.7 bits (66), Expect(2) = 0.028 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 473 PPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PPPP PPPP PP P P+ Sbjct: 471 PPPPMGMMPPPPPPPSGQPPPPPSGPLPPW 500 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 535 PPXXXXXXPXPPPP--XXPXPP--PPPPXXXPXPXPPXP 431 PP P PPPP P PP P PP PP P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPP 510 Score = 27.1 bits (57), Expect(2) = 0.028 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P P + PPP P P P PPP Sbjct: 421 PPPWMQPPPPPMNQGPHPPGHHGPPP 446 >BC002914-1|AAH02914.1| 358|Homo sapiens WIPF1 protein protein. Length = 358 Score = 47.6 bits (108), Expect = 6e-05 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GGG GGGG G GGGGGG GG GGGG G GG + G Sbjct: 68 GGGGGGFGGGG----GFGGGGGGGGGGSFGGGGPPGLGGLFQAG 107 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 350 KXXKXKKXXXKKRGVXXXXXXXGGGXXGXGGX--GXRGXXGGGGGGXGGXXGGGG 508 K K KK R G G G GG G G GGGGGG GG GGGG Sbjct: 42 KGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGG 96 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GGGG G GG GGGG GGG G G Sbjct: 64 GAGAGGGGG----GFGGGGGFGGGGGGGGGGSFGGGGPPGLGG 102 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -1 Query: 521 PPXPXPPPPXXP-PXPPPPPPXXPXXXXPPPPXXPP 417 PP P P P P PPPPP P P P PP Sbjct: 204 PPVPGGPRQPSPGPTPPPPPVRDPPGRSGPLPPPPP 239 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GGGGGG G GG G G G G G G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLG 101 Score = 33.5 bits (73), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 8/49 (16%) Frame = -1 Query: 536 PPLXPPPXPXPPPP--------XXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP P P P PP P P P PPPP PP Sbjct: 180 PDSIPPPVPSTPRPIQSSLHNRGSPPVPGGPRQPSPGPTPPPPPVRDPP 228 Score = 33.5 bits (73), Expect = 1.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PP+ P P P PP P PP PPPP Sbjct: 204 PPVPGGPRQPSPGPTPPPPPVRDPPGRSGPLPPPPP 239 Score = 32.7 bits (71), Expect = 1.8 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXP-PXPPPPP 465 P P PPP P PP P PPPPP Sbjct: 213 PSPGPTPPPPPVRDPPGRSGPLPPPPP 239 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +G GGGGG G GG G GG G G Sbjct: 63 KGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 >AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protein protein. Length = 503 Score = 47.6 bits (108), Expect = 6e-05 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GGG GGGG G GGGGGG GG GGGG G GG + G Sbjct: 68 GGGGGGFGGGG----GFGGGGGGGGGGSFGGGGPPGLGGLFQAG 107 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 350 KXXKXKKXXXKKRGVXXXXXXXGGGXXGXGGX--GXRGXXGGGGGGXGGXXGGGG 508 K K KK R G G G GG G G GGGGGG GG GGGG Sbjct: 42 KGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGG 96 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GGGG G GG GGGG GGG G G Sbjct: 64 GAGAGGGGG----GFGGGGGFGGGGGGGGGGSFGGGGPPGLGG 102 Score = 37.5 bits (83), Expect = 0.065 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PPP P P P P P P P PPPP P P P Sbjct: 283 PPPPPQNNKPPVPSTPRPSAPHRPHL-RPPPPSRPGPPP 320 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPL P P PP PPPP P P PP PPP Sbjct: 346 PPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPP--PPP 384 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GGGGGG G GG G G G G G G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLG 101 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP--PPPPPXXPXXXXPPPPXXP 420 P P PP P P P P P PPPP P PPP P Sbjct: 285 PPPQNNKPPVPSTPRPSAPHRPHLRPPPPSRPG----PPPLPP 323 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-----PPPPXXPPPXP 408 PPL PP P PP PPPP P PPP PP P Sbjct: 250 PPL--PPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P PPPP P PP P P PP P Sbjct: 346 PPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPP 383 Score = 31.9 bits (69), Expect = 3.2 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 4/74 (5%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXP----PXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPX 427 P P P P P P PPPP P PP P PR P P Sbjct: 250 PPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPP--PQNNKPPVPSTPRPSAPHRPH 307 Query: 426 XPPPXXXXXXXTPL 385 PP PL Sbjct: 308 LRPPPPSRPGPPPL 321 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -3 Query: 534 PPXXXXXXXPPPPXXP-PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTP 388 PP PP P P P P P P P P P PP TP Sbjct: 283 PPPPPQNNKPPVPSTPRPSAPHRPHLRPPPPSRPGPPPLPPSSSGNDETP 332 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +G GGGGG G GG G GG G G Sbjct: 63 KGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 >AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. Length = 503 Score = 47.6 bits (108), Expect = 6e-05 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG-XGXGGGXRGG 537 G GGG GGGG G GGGGGG GG GGGG G GG + G Sbjct: 68 GGGGGGFGGGG----GFGGGGGGGGGGSFGGGGPPGLGGLFQAG 107 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 350 KXXKXKKXXXKKRGVXXXXXXXGGGXXGXGGX--GXRGXXGGGGGGXGGXXGGGG 508 K K KK R G G G GG G G GGGGGG GG GGGG Sbjct: 42 KGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGG 96 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GGGG G GG GGGG GGG G G Sbjct: 64 GAGAGGGGG----GFGGGGGFGGGGGGGGGGSFGGGGPPGLGG 102 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPL P P PP PPPP P P PP PPP Sbjct: 346 PPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPP--PPP 384 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P P PP P P P PPPPP P PPP P Sbjct: 285 PPPQNNKPPVPSTPRPSASSQAPPPPP--PPSRPGPPPLPP 323 Score = 33.9 bits (74), Expect = 0.80 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PP P P P PPPP P P Sbjct: 284 PPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGP 318 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GGGGGG G GG G G G G G G Sbjct: 64 GAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLG 101 Score = 33.5 bits (73), Expect = 1.1 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = -1 Query: 542 PXPPLXPPPX----PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ P PPPP PP P P PP PPP Sbjct: 267 PPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPP 313 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPP 464 P P P PPPP P PPP PP Sbjct: 295 PSTPRPSASSQAPPPPPPPSRPGPPPLPP 323 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-----PPPPXXPPPXP 408 PPL PP P PP PPPP P PPP PP P Sbjct: 250 PPL--PPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P PPPP P PP P P PP P Sbjct: 346 PPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPP 383 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXP-----PPPPPXXPXXXXPPP 432 PP PPP PP P P PPPP P PPP Sbjct: 283 PP--PPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPP 320 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPP-XXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP P P P P PP P P PPP P Sbjct: 180 PDSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFP 223 Score = 30.3 bits (65), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 452 RGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 +G GGGGG G GG G GG G G Sbjct: 63 KGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGG 95 >AC004079-3|AAS00376.1| 443|Homo sapiens unknown protein. Length = 443 Score = 47.6 bits (108), Expect = 6e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PPL PPP PP PP P P PP PPP PP Sbjct: 88 PPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPP 128 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPX-XPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPFFS 378 P PP PP P PP P PP P P P P PP P P K P + Sbjct: 92 PPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPPQNASNNPTPANAAKSPLLN 147 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P PP PPPP P P PP P P P P PP Sbjct: 79 PSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPP 121 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PPPP P P PP P P P PPP Sbjct: 82 PPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPP 122 Score = 39.9 bits (89), Expect = 0.012 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PP PPPP P PP P PP P P Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPP 121 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PP PP PP PP PP P P P P P PP P Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPP 122 Score = 38.3 bits (85), Expect = 0.037 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP P P PP P+ P P PPP Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPP 122 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXX-PXPPPPPPXXXPXPXPPXP 431 P P P PP P P PP P PP P P P P P Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASP 127 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXP-XXPPPXXXXXXXTP 388 P PP PP P P P P P PP P PP TP Sbjct: 83 PSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPPQNASNNPTP 137 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PPP PP P P P PPPP Sbjct: 288 PYEPQSPPPFSKPPQGTYGLPPASYPASLPSCAPPPPP 325 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXP-XPPPPPPXXXPXPXPPXPXXXPP 416 P P PP PP P P P PP P PP PP Sbjct: 78 PPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPP 128 >X52426-1|CAA36673.1| 420|Homo sapiens cytokeratin 13 protein. Length = 420 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GG G GG G G GG GGG G G GGG GG G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFG 82 Score = 46.8 bits (106), Expect = 1e-04 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG G GG G GG GGG GG GGG G G GGG GG Sbjct: 44 GYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG GGG G GG G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GG GGG G GGG G G Sbjct: 55 GGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGG 535 G G G G G G GGG GGG GG GG GG Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGG 98 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGG-GXGGXXGGG-GXXXXXXXGGXXGXG 550 GG G G G GGG G G GG GGG G GG G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXG-GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG G GGG G GG G G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXX---GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G GGG G G Sbjct: 15 GFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSGFG 62 >J04029-1|AAA60544.1| 561|Homo sapiens keratin 10 protein. Length = 561 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG---GXGXGGGXRGG 537 G GGG GGGG G GGG GG GGG G G GGG G Sbjct: 496 GYGGGSFGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGGYGGGSSSG 541 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG G G GGGGGG GG GGG GGG GG Sbjct: 488 GHGGSSSGGYGG---GSFGGGGGGYGGGSSGGGSSSGGGYGGG 527 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG GG GG G GGG G GGG GG Sbjct: 469 GSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGGGGGYGG 511 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 415 GGGXXGGG--GXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGG 537 GGG GGG G G GG GG GG GGGG G GGG GG Sbjct: 472 GGGSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGGGGGYGGGSSGG 516 Score = 43.6 bits (98), Expect = 0.001 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GG GG GGG G G GG G Sbjct: 479 GYGGGSSSGGHGGSSSGGYGGGSFGGGGGGYGGGSSGGGSSSGGGYG 525 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GG GGG G GGGG G GG GG G G GG Sbjct: 93 GSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGG 130 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 415 GGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG G G G GGGG GG GGG G GG Sbjct: 96 GGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 133 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXG--GGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GGG G GGG G GG GGG G G GGG G G Sbjct: 88 GGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 133 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG GG GGG GG GGG G GG GG G Sbjct: 448 GEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYG-GGSSSGGHG 490 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGG--GXGXGGGXRGGXG 543 G GG GGG G GG GGG GG GGG G GG GG G Sbjct: 450 GSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYG 498 Score = 41.1 bits (92), Expect = 0.005 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXG---GGGXXXXGXXGGGGGG---XGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGG G GGG GG GG G G GGG GG G Sbjct: 456 GRGGGSFGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGGG 506 Score = 41.1 bits (92), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGG GG GGG GG G Sbjct: 498 GGGSFGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGGYGGGSSSGG 542 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G G GGGGGG GG GGG GG G Sbjct: 488 GHGGSSSGGYGG-GSFGGGGGGYGGGSSGGGSSSGGGYGGGSSSG 531 Score = 37.5 bits (83), Expect = 0.065 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G GG GG GG GGG GG G G Sbjct: 483 GSSSGGHGGSSSGGYGGGSFGGGGGGYGGGSSGGGSSSGGGYGGG 527 Score = 36.7 bits (81), Expect = 0.11 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGG G GGG G GG GGG G GG GG Sbjct: 504 GGGGGY--GGGSSGGGSSSGGGYG-GGSSSGGGYG-GGSSSGG 542 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GGG GG GGG GGG GG G Sbjct: 83 GSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFG 125 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 409 GXGGGXXGGG------GXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G G GGG G G GG GG G GGG GG Sbjct: 72 GFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGG 122 Score = 34.3 bits (75), Expect = 0.60 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGG-XGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G G G G G GG G GG G GG G G G G Sbjct: 467 GGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGGGGGYGGGSSGGGSSSGGGYGG 526 Query: 594 G 596 G Sbjct: 527 G 527 Score = 33.9 bits (74), Expect = 0.80 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +1 Query: 415 GGGXXGGG---GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G G GGG GG G GG G GG RG G Sbjct: 37 GGGFSSGGFSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFRGSYG 83 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXX 557 G G GG G G GGGGGG G GG GG G Sbjct: 474 GSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGG 533 Query: 558 XXG 566 G Sbjct: 534 YGG 536 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G GG GG GGGG GG G G G G Sbjct: 478 GGYGGGSSSGGHGGSSSGGYGGGSFGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGGYGGG 537 Score = 33.5 bits (73), Expect = 1.1 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 16/59 (27%) Frame = +1 Query: 415 GGGXXGG--GGXXXXGXXGGG-----------GGGXGGXXGG---GGXGXGGGXRGGXG 543 GGG GG GG G GGG GG GG GG GG GGG GG G Sbjct: 56 GGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGG 114 Score = 33.5 bits (73), Expect = 1.1 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G GG G G GGG G G GG G G G G G Sbjct: 457 RGGGSFG-GGYGGG-SSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGG 505 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G GGG G G GGG G G G G G G Sbjct: 453 GGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGG 505 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGG-GXGXXXXXXGGXXGXG 551 G GG G GGG G G GGG G G GG G Sbjct: 456 GRGGGSFGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGG 496 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GGG GG G GG GG G G Sbjct: 463 GGGYGGGSSGG-GSSGGGYGGGSSSGGHGGSSSGGYGGGSFGGG 505 Score = 32.7 bits (71), Expect = 1.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 431 GXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G GG GGG GG GGG GG G Sbjct: 448 GEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGSSSGG 488 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 RG G G GGG G G GGG G GG G G G Sbjct: 79 RGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 133 Score = 31.5 bits (68), Expect = 4.2 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G + GG G G GG G G GGG G GG G G Sbjct: 62 GSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGG 119 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 387 GXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G F GG G G G GG G G GG G G G Sbjct: 500 GSFGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGGYGGGSSSGGHKSSSSGSVG 552 >BC126184-1|AAI26185.1| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GG G GG G G GG GGG G G GGG GG G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFG 82 Score = 46.8 bits (106), Expect = 1e-04 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG G GG G GG GGG GG GGG G G GGG GG Sbjct: 44 GYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG GGG G GG G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GG GGG G GGG G G Sbjct: 55 GGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGG 535 G G G G G G GGG GGG GG GG GG Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGG 98 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGG-GXGGXXGGG-GXXXXXXXGGXXGXG 550 GG G G G GGG G G GG GGG G GG G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXG-GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG G GGG G GG G G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXX---GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G GGG G G Sbjct: 15 GFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSGFG 62 >BC110383-1|AAI10384.1| 594|Homo sapiens FIP1 like 1 (S. cerevisiae) protein. Length = 594 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 PP PP P PPPP PP P PP P PPPP PPP Sbjct: 357 PPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 402 Score = 44.4 bits (100), Expect = 6e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP P PP P PP P PPP Sbjct: 356 PPPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 402 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPX-PPPPXXPXPPP--PPPXXXPXPXPPXPXXXPPL 413 P PP P PPPP PP PPP P P P P P + Sbjct: 362 PGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTI 408 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 476 PPP--PPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXP 354 PPP PP P PPPP PP P P F P Sbjct: 356 PPPFFPPGAPPTHLPPPPFL-PPPPTVSTAPPLIPPPGFPPPP 397 >BC077718-1|AAH77718.2| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GG G GG G G GG GGG G G GGG GG G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFG 82 Score = 46.8 bits (106), Expect = 1e-04 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG G GG G GG GGG GG GGG G G GGG GG Sbjct: 44 GYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG GGG G GG G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GG GGG G GGG G G Sbjct: 55 GGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGG 535 G G G G G G GGG GGG GG GG GG Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGG 98 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGG-GXGGXXGGG-GXXXXXXXGGXXGXG 550 GG G G G GGG G G GG GGG G GG G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXG-GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG G GGG G GG G G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXX---GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G GGG G G Sbjct: 15 GFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSGFG 62 >BC052959-1|AAH52959.1| 559|Homo sapiens FIP1L1 protein protein. Length = 559 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 PP PP P PPPP PP P PP P PPPP PPP Sbjct: 322 PPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 367 Score = 44.4 bits (100), Expect = 6e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP P PP P PP P PPP Sbjct: 321 PPPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 367 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPX-PPPPXXPXPPP--PPPXXXPXPXPPXPXXXPPL 413 P PP P PPPP PP PPP P P P P P + Sbjct: 327 PGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTI 373 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 476 PPP--PPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXP 354 PPP PP P PPPP PP P P F P Sbjct: 321 PPPFFPPGAPPTHLPPPPFL-PPPPTVSTAPPLIPPPGFPPPP 362 >BC043258-1|AAH43258.2| 915|Homo sapiens FBXO11 protein protein. Length = 915 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P P PP PPPPP PPPP PPP P Sbjct: 15 PPQQPPPQP---PQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 56 Score = 41.1 bits (92), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP------XXPPXPPPPPPXXP 453 P PP PP PPPP PP PPPPPP P Sbjct: 21 PQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 56 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX----PPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPP P PPPPP + PP P PPP Sbjct: 5 PRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPP 53 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX------PPXPPPPPPXXPR 451 P P P PPPP PP PPPPPP P+ Sbjct: 19 PPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQ 57 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PP PPPPP + PP P PPP Sbjct: 16 PQQPPPQPPQQQPPQQQ----PPPPPQQQQQQQPPPPPPPPPP 54 Score = 30.3 bits (65), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP PPP P PPP P Sbjct: 20 PPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 56 >BC024016-1|AAH24016.1| 559|Homo sapiens FIP1L1 protein protein. Length = 559 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 PP PP P PPPP PP P PP P PPPP PPP Sbjct: 322 PPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 367 Score = 44.4 bits (100), Expect = 6e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP P PP P PP P PPP Sbjct: 321 PPPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 367 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPX-PPPPXXPXPPP--PPPXXXPXPXPPXPXXXPPL 413 P PP P PPPP PP PPP P P P P P + Sbjct: 327 PGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTI 373 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 476 PPP--PPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXP 354 PPP PP P PPPP PP P P F P Sbjct: 321 PPPFFPPGAPPTHLPPPPFL-PPPPTVSTAPPLIPPPGFPPPP 362 >BC011543-1|AAH11543.1| 328|Homo sapiens FIP1L1 protein protein. Length = 328 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 PP PP P PPPP PP P PP P PPPP PPP Sbjct: 91 PPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 136 Score = 44.4 bits (100), Expect = 6e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP P PP P PP P PPP Sbjct: 90 PPPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 136 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPX-PPPPXXPXPPP--PPPXXXPXPXPPXPXXXPPL 413 P PP P PPPP PP PPP P P P P P + Sbjct: 96 PGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTI 142 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 476 PPP--PPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXP 354 PPP PP P PPPP PP P P F P Sbjct: 90 PPPFFPPGAPPTHLPPPPFL-PPPPTVSTAPPLIPPPGFPPPP 131 >BC002661-1|AAH02661.3| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GG G GG G G GG GGG G G GGG GG G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFG 82 Score = 46.8 bits (106), Expect = 1e-04 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG G GG G GG GGG GG GGG G G GGG GG Sbjct: 44 GYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG GGG G GG G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GG GGG G GGG G G Sbjct: 55 GGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGG 535 G G G G G G GGG GGG GG GG GG Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGG 98 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGG-GXGGXXGGG-GXXXXXXXGGXXGXG 550 GG G G G GGG G G GG GGG G GG G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXG-GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG G GGG G GG G G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXX---GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G GGG G G Sbjct: 15 GFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSGFG 62 >AY827075-1|AAV87312.1| 927|Homo sapiens F-box protein 11 protein. Length = 927 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P P PP PPPPP PPPP PPP P Sbjct: 27 PPQQPPPQP---PQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 68 Score = 41.1 bits (92), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP------XXPPXPPPPPPXXP 453 P PP PP PPPP PP PPPPPP P Sbjct: 33 PQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 68 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX----PPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPP P PPPPP + PP P PPP Sbjct: 17 PRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPP 65 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX------PPXPPPPPPXXPR 451 P P P PPPP PP PPPPPP P+ Sbjct: 31 PPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQ 69 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PP PPPPP + PP P PPP Sbjct: 28 PQQPPPQPPQQQPPQQQ----PPPPPQQQQQQQPPPPPPPPPP 66 Score = 30.3 bits (65), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP PPP P PPP P Sbjct: 32 PPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 68 >AY366510-1|AAQ88277.1| 594|Homo sapiens pre-mRNA 3'end processing factor FIP1 protein. Length = 594 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPP 414 PP PP P PPPP PP P PP P PPPP PPP Sbjct: 357 PPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 402 Score = 44.4 bits (100), Expect = 6e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP--PPPPPXXPRXPXPPXPXXPPP 415 P P PP PPPP PP P PP P PP P PPP Sbjct: 356 PPPFFPPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPP 402 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -2 Query: 544 PXXPPXXXXXXPX-PPPPXXPXPPP--PPPXXXPXPXPPXPXXXPPL 413 P PP P PPPP PP PPP P P P P P + Sbjct: 362 PGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTI 408 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -1 Query: 476 PPP--PPXXPXXXXPPPPXXPPPXPXXXXKXPFFSXXXFXXXP 354 PPP PP P PPPP PP P P F P Sbjct: 356 PPPFFPPGAPPTHLPPPPFL-PPPPTVSTAPPLIPPPGFPPPP 397 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P L PP P PPPP PP PPPP PPPP PPP P Sbjct: 648 PNKALVHPPPP-PPPPPPPPLALPPPP-------PPPPPLPPPLP 684 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPP 417 PP PPP P PP PP PPPP PP P P PP Sbjct: 655 PPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDQKQPP 696 Score = 38.3 bits (85), Expect = 0.037 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P PPP P P P Sbjct: 657 PPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDQKQPP 696 Score = 35.9 bits (79), Expect = 0.20 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P PP PPPP PP PPP P Sbjct: 656 PPPPPPPPPPPLALPPPPPPPPPLPPPLP 684 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP PPPP P P PPP P P PP+ Sbjct: 655 PPPPPPPPPPPPLALPPPPPPPPPLPPP---LPNAEVPSDQKQPPV 697 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PPPPPP P PP PPP PL Sbjct: 655 PPPPPPPP-----PPPPLALPPPPPPPPPLPPPL 683 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P L PP P PPPP PP PPPP PPPP PPP P Sbjct: 330 PNKALVHPPPP-PPPPPPPPLALPPPP-------PPPPPLPPPLP 366 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPP 417 PP PPP P PP PP PPPP PP P P PP Sbjct: 337 PPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDQKQPP 378 Score = 38.3 bits (85), Expect = 0.037 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P PPP P P P Sbjct: 339 PPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDQKQPP 378 Score = 35.9 bits (79), Expect = 0.20 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P PP PPPP PP PPP P Sbjct: 338 PPPPPPPPPPPLALPPPPPPPPPLPPPLP 366 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP PPPP P P PPP P P PP+ Sbjct: 337 PPPPPPPPPPPPLALPPPPPPPPPLPPP---LPNAEVPSDQKQPPV 379 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PPPPPP P PP PPP PL Sbjct: 337 PPPPPPPP-----PPPPLALPPPPPPPPPLPPPL 365 >AF176706-1|AAF17611.1| 192|Homo sapiens F-box protein FBX11 protein. Length = 192 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P P PP PPPPP PPPP PPP P Sbjct: 8 PPQQPPPQP---PQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 49 Score = 41.1 bits (92), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP------XXPPXPPPPPPXXP 453 P PP PP PPPP PP PPPPPP P Sbjct: 14 PQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 49 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX------PPXPPPPPPXXPR 451 P P P PPPP PP PPPPPP P+ Sbjct: 12 PPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQ 50 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PP PPPPP + PP P PPP Sbjct: 9 PQQPPPQPPQQQPPQQQ----PPPPPQQQQQQQPPPPPPPPPP 47 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 8/39 (20%) Frame = -3 Query: 507 PPPPXXPPXP--------PPPPPXXPRXPXPPXPXXPPP 415 PP P P PPPPP + PP P PPP Sbjct: 8 PPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPP 46 Score = 30.3 bits (65), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP PPP P PPP P Sbjct: 13 PPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 49 >AF174599-1|AAF04520.1| 197|Homo sapiens F-box protein Fbx11 protein. Length = 197 Score = 47.2 bits (107), Expect = 8e-05 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPX--PPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P P PP PPPPP PPPP PPP P Sbjct: 12 PPQQPPPQP---PQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 53 Score = 41.1 bits (92), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP------XXPPXPPPPPPXXP 453 P PP PP PPPP PP PPPPPP P Sbjct: 18 PQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 53 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX----PPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPP P PPPPP + PP P PPP Sbjct: 2 PRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPP 50 Score = 34.7 bits (76), Expect = 0.46 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXX------PPXPPPPPPXXPR 451 P P P PPPP PP PPPPPP P+ Sbjct: 16 PPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQ 54 Score = 33.9 bits (74), Expect = 0.80 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P PP PP PPPPP + PP P PPP Sbjct: 13 PQQPPPQPPQQQPPQQQ----PPPPPQQQQQQQPPPPPPPPPP 51 Score = 30.3 bits (65), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP 467 P P P PP PPP P PPP P Sbjct: 17 PPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLP 53 >AF049259-1|AAC35754.1| 420|Homo sapiens keratin 13 protein. Length = 420 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GG G GG G G GG GGG G G GGG GG G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFG 82 Score = 46.8 bits (106), Expect = 1e-04 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG G GG G GG GGG GG GGG G G GGG GG Sbjct: 44 GYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG GGG G GG G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GG GGG G GGG G G Sbjct: 55 GGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGG 535 G G G G G G GGG GGG GG GG GG Sbjct: 58 GSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGG 98 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGG-GXGGXXGGG-GXXXXXXXGGXXGXG 550 GG G G G GGG G G GG GGG G GG G G Sbjct: 39 GGSAGGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXG-GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG G GGG G GG G G G Sbjct: 43 GGYGGGVSCGFGGGAGSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXX---GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G GGG G G Sbjct: 15 GFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSGFG 62 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 47.2 bits (107), Expect = 8e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P L PP P PPPP PP PPPP PPPP PPP P Sbjct: 1414 PNKALVHPPPP-PPPPPPPPLALPPPP-------PPPPPLPPPLP 1450 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPP 417 PP PPP P PP PP PPPP PP P P PP Sbjct: 1421 PPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDQKQPP 1462 Score = 38.3 bits (85), Expect = 0.037 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXP 431 P P PP P PPPP P PPP P P P Sbjct: 1423 PPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDQKQPP 1462 Score = 35.9 bits (79), Expect = 0.20 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P PP PPPP PP PPP P Sbjct: 1422 PPPPPPPPPPPLALPPPPPPPPPLPPPLP 1450 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP PPPP P P PPP P P PP+ Sbjct: 1421 PPPPPPPPPPPPLALPPPPPPPPPLPPP---LPNAEVPSDQKQPPV 1463 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 486 PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PPPPPP P PP PPP PL Sbjct: 1421 PPPPPPPP-----PPPPLALPPPPPPPPPLPPPL 1449 >X14640-1|CAA32786.1| 458|Homo sapiens keratin 13 protein. Length = 458 Score = 46.8 bits (106), Expect = 1e-04 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG G GG G GG GGG GG GGG G G GGG GG Sbjct: 44 GYGGGVSCGFGGGADSGFGGGYGGGLGGGYGGGLGGGFGGGFAGG 88 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GG G GG G GG GGG G G GGG GG G Sbjct: 39 GGSAGGYGGGVSCGFGGGADSGFGGGYGGGLGGGYGGGLGGGFG 82 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG GGG G GG G G Sbjct: 43 GGYGGGVSCGFGGGADSGFGGGYGGGLGGGYGGGLGGG 80 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GG GGG G GGG G G Sbjct: 55 GGADSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 32.7 bits (71), Expect = 1.8 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 417 GGXXXGXG-GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GGG G GGG G GG G G G Sbjct: 43 GGYGGGVSCGFGGGADSGFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDG 97 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXX---GGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G GGG G G Sbjct: 15 GFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGADSGFG 62 Score = 31.1 bits (67), Expect = 5.6 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXR-GXXGGGGGGXGGXXGGG-GXXXXXXXGGXXGXG 550 GG G G G G GG G GG GGG G GG G G Sbjct: 39 GGSAGGYGGGVSCGFGGGADSGFGGGYGGGLGGGYGGGLGGGFGGG 84 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 422 GXXGXGGXGXRGXXGGG-GGGXGGXXGGGGXXXXXXXGG 535 G G G G G GGG GGG GG GG GG Sbjct: 60 GFGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGG 98 >X14487-1|CAA32649.1| 593|Homo sapiens protein ( Human gene for acidic (type I) cytokeratin 10. ). Length = 593 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG G G GGGGGG GG GGG GGG GG Sbjct: 530 GHGGSSSGGYGG---GSSGGGGGGYGGGSSGGGSSSGGGYGGG 569 Score = 45.2 bits (102), Expect = 3e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 G GGG GGG G GGG GG GG G G GGG GG Sbjct: 463 GRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGG 506 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GG GG GGG G G GG G Sbjct: 521 GHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYG 567 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GG GG GG GGG G GG GG G Sbjct: 464 RGGGSFGGGYGGGSSGGGSSGG-GYGGGHGGSSGGGYGGGSSG-GGSSGGGYG 514 Score = 44.0 bits (99), Expect = 7e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +1 Query: 409 GXGGGXXGGG--GXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G G GG GG GG GGGG G GGG GG Sbjct: 512 GYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGG 558 Score = 43.6 bits (98), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GGG GG GGG G GG GG Sbjct: 457 GSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGG 501 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GG G G GGG G G GG G G G GG Sbjct: 484 GGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGG 524 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GG GGG G GGGG G GG GG G G GG Sbjct: 100 GSFGGGNFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGG 137 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 415 GGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG G G G GGGG GG GGG G GG Sbjct: 103 GGGNFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 140 Score = 41.9 bits (94), Expect = 0.003 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGG-GXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 GGG GGG G G GGG GG GG GGG G GG GG G Sbjct: 479 GGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYG-GGSSSGGHG 523 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGX--GGXXGGGGXGXGGGXRGGXG 543 G GG GGG GG GGG GG G G GGG GG G Sbjct: 502 GSSGGGSSGGGYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGG 548 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGG GGGG G GGG GG GGG G Sbjct: 538 GYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGG 574 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXG--GGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GGG G GGG G GG GGG G G GGG G G Sbjct: 95 GGSYGGSFGGGNFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 140 Score = 41.5 bits (93), Expect = 0.004 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXG-GGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GG G GGG GGG GG GG G GG GG G Sbjct: 486 GYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHG-GGSSSGGHG 532 Score = 41.5 bits (93), Expect = 0.004 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +1 Query: 415 GGGXXGG---GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GG GG GG GG G GGG G GGG GG Sbjct: 510 GGGYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGG 553 Score = 41.1 bits (92), Expect = 0.005 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGX--GGXXGGG-GXGXGGGXRGGXG 543 G G GGGG GG GGG GG GGG G G GG GG G Sbjct: 455 GEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYG 500 Score = 40.3 bits (90), Expect = 0.009 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Frame = +1 Query: 415 GGGXXGGG--GXXXXGXXGGG--GGGXGGXXGGG-GXGXGGGXRGGXG 543 GGG GGG G G GGG GG GG GG G G GG GG G Sbjct: 505 GGGSSGGGYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYG 552 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGGXG 543 G GG GG G GGG GG GG GG GGG G G Sbjct: 520 GGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGG 565 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G G GGGGGG GG GGG GG G Sbjct: 530 GHGGSSSGGYGG-GSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSG 573 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G GG GG GG GGG GG G G Sbjct: 525 GSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGG 569 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG G GGG G G GGG G GG G G G G Sbjct: 463 GRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGG 511 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGGGX--GXGGGXRGGXG 543 G GG GGG GG GGG G GGG G GG GG G Sbjct: 493 GSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGGSSSGGHGGSSSGGYG 540 Score = 37.9 bits (84), Expect = 0.049 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G G G G GGG G GGG GG G GG G Sbjct: 465 GGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGG-GSSSGGHG 523 Query: 508 XGXGGGXRGG 537 G G GG Sbjct: 524 GGSSSGGHGG 533 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GGG G GGG G GG G G G G Sbjct: 462 GGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGG 521 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GGG GG GGG GGG GG G Sbjct: 90 GSSSFGGSYGGSFGGGNFGGGSFGGGSFGGGGFGGGGFGGGFG 132 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GG GG GG G G GG G Sbjct: 485 GGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGGSSSG 529 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG G GGG GG G Sbjct: 537 GGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSG 581 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG GG G RG G Sbjct: 19 GGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSG 63 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 409 GXGGGXXGGG------GXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G G GGG G G GG GG G GGG GG Sbjct: 79 GFGGGSFHGSYGSSSFGGSYGGSFGGGNFGGGSFGGGSFGGGGFGGGGFGG 129 Score = 34.3 bits (75), Expect = 0.60 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGG-GGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G G GG GG G GGG G GG G G G G Sbjct: 514 GGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSG 573 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GGG G GGG G G G G G Sbjct: 488 GGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGG 547 Score = 33.9 bits (74), Expect = 0.80 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXX 557 G G GG G G G GG GG GGGG GG G Sbjct: 507 GSSGGGYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGY 566 Query: 558 XXGXXXG 578 G G Sbjct: 567 GGGSSSG 573 Score = 33.5 bits (73), Expect = 1.1 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 16/59 (27%) Frame = +1 Query: 415 GGGXXGG--GGXXXXGXXGGG-----------GGGXGGXXGG---GGXGXGGGXRGGXG 543 GGG GG GG G GGG GG GG GG GG GGG GG G Sbjct: 63 GGGCFGGSSGGYGGLGGFGGGSFHGSYGSSSFGGSYGGSFGGGNFGGGSFGGGSFGGGG 121 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXX 557 G+ G G G G G G GG GG G G G GG G Sbjct: 463 GRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGH 522 Query: 558 XXGXXXG 578 G G Sbjct: 523 GGGSSSG 529 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G GGG G G GGG G G G G G G Sbjct: 460 GGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGG 512 Score = 31.9 bits (69), Expect = 3.2 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +1 Query: 415 GGGXXGGG---GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G G GGG GG G GG G GG G G Sbjct: 44 GGGFSSGGFSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFHGSYG 90 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G GG G G GG G G GG G G G Sbjct: 542 GSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVG 584 Score = 31.5 bits (68), Expect = 4.2 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G + GG G G GG G G GGG G GG G G Sbjct: 69 GSSGGYGGLGGFGGGSFHGSYGSSSFGGSYGGSFGGGNFGGGSFGGGSFGGGGFGGGG 126 Score = 31.1 bits (67), Expect = 5.6 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G GGG G G GG G G G G G G Sbjct: 493 GSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYG 552 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXG 578 GGGGGG G GGGG G G G G G Sbjct: 17 GGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGG 55 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G G GGG G G GGG G GG G G G Sbjct: 95 GGSYGGSFGGGNFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 140 Score = 30.3 bits (65), Expect = 9.8 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGX---GXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G G G G GGG GG G GGG G G G G Sbjct: 480 GGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGGSSSGGHG 532 >M77663-1|AAA59199.1| 384|Homo sapiens keratin 10 protein. Length = 384 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG G G GGGGGG GG GGG GGG GG Sbjct: 321 GHGGSSSGGYGG---GSSGGGGGGYGGGSSGGGSSSGGGYGGG 360 Score = 44.8 bits (101), Expect = 4e-04 Identities = 30/89 (33%), Positives = 31/89 (34%), Gaps = 4/89 (4%) Frame = +1 Query: 283 GXXGXXXKKXXXXXXGXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGG--GXXXXG 456 G G + G G G G GGG GGG G G Sbjct: 261 GSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSG 320 Query: 457 XXGGG--GGGXGGXXGGGGXGXGGGXRGG 537 GG GG GG GGGG G GGG GG Sbjct: 321 GHGGSSSGGYGGGSSGGGGGGYGGGSSGG 349 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GG GG GGG G G GG G Sbjct: 312 GYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYG 358 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGG---GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G G GGG GG G GGG GG GG G Sbjct: 267 GRGGGSFGGGYGGGSSGGGSSGGGHGGSSGGGYGGGSSGGGSSGGGYG 314 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 +G GGG GGG G G GGG GG G G G GGG GG Sbjct: 254 RGLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGSSGGGYGGGSSGG 306 Score = 44.0 bits (99), Expect = 7e-04 Identities = 26/57 (45%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGG--GXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G G GG GGG GG GGG G GG GG G Sbjct: 268 RGGGSFGGGYGGGSSGGGSSGGGHGGSSGGGYGGGSSGGGSSGGGYG-GGSSSGGHG 323 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGG GG G G GGG GG G Sbjct: 298 GYGGGSSGGGSS---GGGYGGGSSSGGHGGSSSGGYGGGSSGGGG 339 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGG GGGG G GGG GG GGG G Sbjct: 329 GYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGG 365 Score = 40.3 bits (90), Expect = 0.009 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 3/75 (4%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXG-GGXXGGGGXXXXGXXGG-GGGGXGGXXGG 501 G G G G G G GG GGG G GG GG GG G Sbjct: 269 GGGSFGGGYGGGSSGGGSSGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSG 328 Query: 502 G-GXGXGGGXRGGXG 543 G G G GG GG G Sbjct: 329 GYGGGSSGGGGGGYG 343 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G G GGGGGG GG GGG GG G Sbjct: 321 GHGGSSSGGYGG-GSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSG 364 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G GG GG GG GGG GG G G Sbjct: 316 GSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGG 360 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G GG G GGG G G GGG G GG G G G G Sbjct: 267 GRGGGSFGGGYGGGSSGGGSSGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGG 321 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG G GGG GG G Sbjct: 328 GGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSG 372 Score = 34.7 bits (76), Expect = 0.46 Identities = 26/105 (24%), Positives = 26/105 (24%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G GG G G G G GG G G G Sbjct: 261 GSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSG 320 Query: 462 XGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G GG G G G G G Sbjct: 321 GHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGG 365 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G GG G G GG G G GG G G G Sbjct: 333 GSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVG 375 >L21990-1|AAA60301.1| 464|Homo sapiens spiceosomal protein protein. Length = 464 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PP P P PPPP PP PP P PP PP PPP P P Sbjct: 242 PPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAP 292 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P P P PP PP PP P P P PP Sbjct: 253 PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPP 297 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP---XXPPXPP-----PPPPXXPXXXXPPPPXXPPP 414 P P PP PPPP PP PP PPPP P PP P P Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PP P PP PP P PP P PP P Sbjct: 252 PPPPPGGLPLPPMPPTGPAPSGPPGPPQLP----PPAPGVHPPAP 292 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ PP P P P PP PPP P PP P PP Sbjct: 260 PLPPM-PPTGPAPSGPPGPPQLPPPAPGV----HPPAPVVHPP 297 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P PP PP P P P PP PP P P Sbjct: 263 PMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVH-PPASGVHPPAPGVHPPAP 313 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP-----PPPPXXPXXXXPPPPXXPPPXP 408 P PP P PP P PP PP P P PPPP P P Sbjct: 217 PPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P PP PP P P PPP P+ Sbjct: 242 PPRPPLPESLP-PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPV 293 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P P PP P P PP P P PPPP Sbjct: 423 PQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXPXXPPP 415 P P P P PP P P P PP P+ P PP P PP Sbjct: 246 PLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLP-PPAPGVHPP 290 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP P P P P PP PP Sbjct: 255 PPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPP 304 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX-PPXPP---PPPPXXPRXPXPPXPXXPP 418 P P PP P PP PP P PP P P P P PP Sbjct: 233 PPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPP 278 Score = 32.3 bits (70), Expect = 2.4 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPX---PPPPXXPPXP---PPPPPXXPXXXX--PPPPXXPPP 414 P PP PPP P P P PP PP P P PP P PP Sbjct: 275 PGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPP 325 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P P PP P PP PP P P PP P PP P P Sbjct: 310 PPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAP 362 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P P P P P P P PPP + P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAP 377 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P PP P PP PPPPP P P P P Sbjct: 228 PGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 31.5 bits (68), Expect = 4.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXX---PPPXPXXXXKXPFFSXXXFXXXPX 351 PP P P P PP PPP P PP PPP P P P Sbjct: 217 PPAP-PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPP 275 Query: 350 XXXXXPXP 327 P P Sbjct: 276 GPPQLPPP 283 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP PP PP P PP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPP 255 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP PP P PP PP Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P P PP P PP P P P P Sbjct: 254 PPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAP 313 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + PP P PP P P P P P PP P P P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAP 384 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + P PP P P P P PP P P PPP P Sbjct: 419 PGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = -3 Query: 507 PPPPXXPPXPP----PPPPXX----PRXPXPPXPXXPPP 415 P PP P PP PPPP PR P P PPP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPP 256 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PP PPPPP P PP Sbjct: 220 PPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPP 266 Score = 30.7 bits (66), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXP--XPPXPXXPPP 415 P P P P P PP P PP P P P PP P PP Sbjct: 318 PAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP 367 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 PP P PP PP P P PP P PP P P Sbjct: 303 PPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAP 348 >BC125224-1|AAI25225.1| 748|Homo sapiens LRCH2 protein protein. Length = 748 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/39 (56%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 430 GGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 GGGG G GGGG G G GGGG G GGG GG G Sbjct: 6 GGGGNSGGGGCGGGGSSGGCGTAGGGGGGAGGGGGGGGG 44 Score = 45.6 bits (103), Expect = 2e-04 Identities = 22/38 (57%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGG 522 GGG GGGG G GG G GG GG GGGG G GG Sbjct: 7 GGGNSGGGGCGGGGSSGGCGTAGGGGGGAGGGGGGGGG 44 Score = 44.4 bits (100), Expect = 6e-04 Identities = 22/41 (53%), Positives = 22/41 (53%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GGG G GG G GG GGGG G GGG GG Sbjct: 6 GGGGNSGGGGCGGGGSSGGCGTAGG--GGGGAGGGGGGGGG 44 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG 504 G GGG GG G GG GGG GG GGG Sbjct: 15 GCGGGGSSGGCGTAGGGGGGAGGGGGG--GGG 44 Score = 32.7 bits (71), Expect = 1.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 437 GGXGXRGXXG-GGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G GGGG GG GG GG G G Sbjct: 6 GGGGNSGGGGCGGGGSSGGCGTAGGGGGGAGGGGGGGGG 44 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG GG G GGG G GG G G G Sbjct: 8 GGNSGGGGCGGGGSSGGCGTAGGGGGGAGGGGGG 41 >BC044636-1|AAH44636.1| 520|Homo sapiens YLPM1 protein protein. Length = 520 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP--PPXXPXXXXP---PPPXXPPPXP 408 PPP P PPP PP PPP PP P P PPP PP P Sbjct: 355 PPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLP 398 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 8/49 (16%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP+ PPP PPP PP PPP P P PPP PPP Sbjct: 416 PPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPP 464 Score = 39.5 bits (88), Expect = 0.016 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPP--PPXXPPP 414 P P + PP P PPP PP P PPP P PP P PPP Sbjct: 357 PLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPPP 404 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = -1 Query: 536 PPLXPPPXPXP-PPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP+ PP P PPP PP PPP P PPP PPP Sbjct: 390 PPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPP 436 Score = 38.3 bits (85), Expect = 0.037 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -1 Query: 536 PPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP PP PP P PPP PPP PPP Sbjct: 380 PATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPP 422 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP PP PPP P P P P PPP Sbjct: 415 PPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPP 464 Score = 37.5 bits (83), Expect = 0.065 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPP--PPPXXPXXXXP--PPPXXPP 417 PP+ PP P P PP PPP PPP P PPP PP Sbjct: 363 PPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPPPGMPP 408 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPP--PPPXXPXXXXP--PPPXXPPP 414 PP P P P P PP PP PPP P PPP PPP Sbjct: 346 PPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPP 391 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PP P P PP P P P P P P L Sbjct: 345 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSL 397 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPP PPP P PPP P P Sbjct: 415 PPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLP 450 Score = 31.9 bits (69), Expect = 3.2 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXP--PPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P PP P P PP PPP PP PP P PP Sbjct: 380 PATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSSAGPP-PVLPPP 436 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -1 Query: 503 PPPXXP--PXPPPPPPXXPXXXXP--PPPXXPPPXP 408 PPP P PPP P P P PPP PP P Sbjct: 345 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALP 380 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPPXXXPXPXPP-XPXXXPP 416 P P P P P PPP P P PPP P PP P PP Sbjct: 346 PPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPP 403 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 8/49 (16%) Frame = -1 Query: 536 PPLXPP------PXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPPP 414 PP PP P P PPP PPP PP PPP PP Sbjct: 403 PPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPP 451 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PP P P PPP P P P P Sbjct: 444 PPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVP 480 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXP---PPPXXPXPPPP--PPXXXPXPXPPXPXXXPPL 413 P P PP P P PP PPP PP PP PPL Sbjct: 402 PPPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPL 452 >BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LOC339344 protein. Length = 399 Score = 46.8 bits (106), Expect = 1e-04 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPP--PXXPXXXXPPPPXXPPP 414 P+ P PPP PP PPPPP P PPPP PPP Sbjct: 210 PVQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPPPRPPP 251 Score = 41.9 bits (94), Expect = 0.003 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 PPP P PPPP PP P PPP P P Sbjct: 307 PPPLPPPPPPPPPPRPVLPPPAPKVEITPEP 337 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 PL P PP PP PPPPPP P P P P P Sbjct: 296 PLLPGTPVDSLPPPLPPPPPPPPPPRPVLPPPAPKVEITPEP 337 Score = 39.1 bits (87), Expect = 0.021 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PPP P P PP P PPP Sbjct: 210 PVQLPRLALSPPPPAPPLPP-PPPLAQVAPSPPSPPPPPRPPP 251 Score = 37.9 bits (84), Expect = 0.049 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPP-PPXXPXXXXPPPPXXPPPXP 408 PP P P PP P PP PP P P P PPP P Sbjct: 204 PPSALQPVQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPPP 247 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP 432 P PPL PPP P PP PPPPP P P Sbjct: 223 PAPPLPPPP-PLAQVAPSPPSPPPPPRPPPTLSASDP 258 Score = 37.5 bits (83), Expect = 0.065 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP 465 PP PPP P PPPP P PPP P Sbjct: 307 PPPLPPPPP-PPPPPRPVLPPPAP 329 Score = 37.1 bits (82), Expect = 0.085 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P P P P PPP P PPPPP P PP P P Sbjct: 189 PQEGGCPRPKERESPPPSALQPVQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPPP 247 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P L P P PP PP PPP P PP PPP Sbjct: 204 PPSALQPVQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPP 246 Score = 35.9 bits (79), Expect = 0.20 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PP P PP PPPP P P P P P P Sbjct: 296 PLLPGTPVDSLPPPLPPPPPPPPPPRPVLP-PPAPKVEITPEP 337 Score = 35.5 bits (78), Expect = 0.26 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P PP P P P P P P PPPP P Sbjct: 220 PPPPAPPLPPPPPLAQVAPSPPSPPPPPRP 249 Score = 33.9 bits (74), Expect = 0.80 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPP 463 P P PP P P PP PP PPP Sbjct: 223 PAPPLPPPPPLAQVAPSPPSPPPPPRPPP 251 Score = 33.5 bits (73), Expect = 1.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 535 PPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 PP P PPP P PP P P P P P L Sbjct: 220 PPPPAPPLPPPPPLAQVAPSPPSPPPPPRPPPTLSASDPSL 260 Score = 33.1 bits (72), Expect = 1.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 505 PPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 PP P P PPPPP P P P P+ Sbjct: 308 PPLPPPPPPPPPPRPVLPPPAPKVEITPEPV 338 Score = 32.3 bits (70), Expect = 2.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXP 445 P PP P PP PP P PPP P Sbjct: 226 PLPPPPPLAQVAPSPPSPPPPPRPPPTLSASDP 258 Score = 31.1 bits (67), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPP 466 P PP PPPP P PPP P Sbjct: 302 PVDSLPPPLPPPPPPPPPPRPVLPPPAP 329 Score = 30.7 bits (66), Expect = 7.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P P P PPPP PPP P P Sbjct: 296 PLLPGTPVDSLPPPLPPPPPPPPPPRPVLPPPAP 329 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP 473 P P P PP P PP P PPP Sbjct: 221 PPPAPPLPPPPPLAQVAPSPPSPPPPPRPPP 251 >BC034697-1|AAH34697.1| 584|Homo sapiens keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) protein. Length = 584 Score = 46.8 bits (106), Expect = 1e-04 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GG G G GGGGGG GG GGG GGG GG Sbjct: 521 GHGGSSSGGYGG---GSSGGGGGGYGGGSSGGGSSSGGGYGGG 560 Score = 45.2 bits (102), Expect = 3e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGG 537 G GGG GGG G GGG GG GG G G GGG GG Sbjct: 463 GRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGG 506 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG GG GG G GGG G GGG GG Sbjct: 502 GSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGG 544 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G G GG GG GG GGG G G GG G Sbjct: 512 GYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYG 558 Score = 44.4 bits (100), Expect = 6e-04 Identities = 23/53 (43%), Positives = 24/53 (45%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GGG GGG G GGG GG G GGG GG GG G Sbjct: 464 RGGGSFGGGYGGGSSGGGSSG--GGYGGGHGGSSGGGYGGGSSGGGSSGGGYG 514 Score = 44.4 bits (100), Expect = 6e-04 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 415 GGGXXGGG--GXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGG 537 GGG GGG G G GG GG GG GGGG G GGG GG Sbjct: 505 GGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGG 549 Score = 43.6 bits (98), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG--GGGGXGGXXGGGGXGXGGGXRGG 537 G GG GGG G GG GGG GG GGG G GG GG Sbjct: 457 GSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGG 501 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 GGG GG G G GGG G G GG G G G GG Sbjct: 484 GGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGG 524 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GG GGG G GGGG G GG GG G G GG Sbjct: 100 GSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGG 137 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 415 GGGXXGGG--GXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 GGG GGG G G G GGGG GG GGG G GG Sbjct: 103 GGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 140 Score = 41.9 bits (94), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGG GG G G GGG GG G Sbjct: 498 GYGGGSSGGGSS---GGGYGGGSSSGGHGGSSSGGYGGGSSGGGG 539 Score = 41.9 bits (94), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGG GGGG G GGG GG GGG G Sbjct: 529 GYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGG 565 Score = 41.5 bits (93), Expect = 0.004 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXG--GGGXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 GG G GGG G GGG G GG GGG G G GGG G G Sbjct: 95 GGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 140 Score = 41.1 bits (92), Expect = 0.005 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGX--GGXXGGG-GXGXGGGXRGGXG 543 G G GGGG GG GGG GG GGG G G GG GG G Sbjct: 455 GEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYG 500 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGGXG 543 G GGG G G G GGG GG GG G GG GG G Sbjct: 486 GYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYG 531 Score = 39.9 bits (89), Expect = 0.012 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGG-GGGGXGGXXGGG-GXGXGGGXRGGXG 543 G GG GGG G GG GG GG GG G G GG GG G Sbjct: 497 GGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYG 543 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGG-GGXGXGGGXRGG 537 GGG GGG G GGG G G GG G G GGG G Sbjct: 479 GGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSG 520 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G G GGGGGG GG GGG GG G Sbjct: 521 GHGGSSSGGYGG-GSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSG 564 Score = 38.7 bits (86), Expect = 0.028 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G GG G GG GG GG GGG GG G G Sbjct: 516 GSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGG 560 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 G GG G GGG G G GGG G GG G G G G Sbjct: 463 GRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGG 511 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GGG G GGG G GG G G G G Sbjct: 462 GGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGG 521 Score = 35.9 bits (79), Expect = 0.20 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GGG GG GGG GGG GG G Sbjct: 90 GSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFG 132 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G GG G GG GG GG G G GG G Sbjct: 485 GGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGG 529 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG G GGG GG G Sbjct: 528 GGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSG 572 Score = 34.7 bits (76), Expect = 0.46 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GG GG G RG G Sbjct: 19 GGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSG 63 Score = 34.7 bits (76), Expect = 0.46 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GGG GG G GGG G G G G G G Sbjct: 480 GGSSGGGYGGGHGGSSGGGYGG-GSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGG 538 Score = 34.3 bits (75), Expect = 0.60 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 8/51 (15%) Frame = +1 Query: 409 GXGGGXXGGG------GXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G G GGG G G GG GG G GGG GG Sbjct: 79 GFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGG 129 Score = 34.3 bits (75), Expect = 0.60 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGG-XGXXXXXXGGXXGXGXXXXGXXXGXXXXX 593 GG G G G G G GG G GG G GG G G G G Sbjct: 500 GGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGG 559 Query: 594 G 596 G Sbjct: 560 G 560 Score = 33.9 bits (74), Expect = 0.80 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +1 Query: 415 GGGXXGGG---GXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 GGG GG G G GGG GG G GG G GG RG G Sbjct: 44 GGGFSSGGFSGGSFSRGSSGGGCFGGSSGGYGGLGGFGGGSFRGSYG 90 Score = 33.5 bits (73), Expect = 1.1 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 16/59 (27%) Frame = +1 Query: 415 GGGXXGG--GGXXXXGXXGGG-----------GGGXGGXXGG---GGXGXGGGXRGGXG 543 GGG GG GG G GGG GG GG GG GG GGG GG G Sbjct: 63 GGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGG 121 Score = 33.1 bits (72), Expect = 1.4 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GGG GG G GG GG G G Sbjct: 496 GGGYGGGSSGG-GSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGG 538 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G GGG G G GGG G G G G G G Sbjct: 460 GGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGG 512 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 RG G G GGG G G GGG G GG G G G Sbjct: 86 RGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGG 140 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGG---GGXXXXXXXGGXXGXG 550 GGG G G G GGG G GG GG GG G G Sbjct: 496 GGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYG 543 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 G G GG G G GG G G GG G G G Sbjct: 533 GSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVG 575 Score = 31.5 bits (68), Expect = 4.2 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G G + GG G G GG G G GGG G GG G G Sbjct: 69 GSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGGGFGGGG 126 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXG-GXXGXGXXXXGXXXG 578 GGGGGG G GGGG G G G G G Sbjct: 17 GGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGG 55 Score = 30.3 bits (65), Expect = 9.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G GGG G GG G G G G Sbjct: 497 GGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGG 541 >BC015804-1|AAH15804.1| 481|Homo sapiens SF3A2 protein protein. Length = 481 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PP P P PPPP PP PP P PP PP PPP P P Sbjct: 242 PPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAP 292 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P P P PP PP PP P P P PP Sbjct: 253 PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPP 297 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP---XXPPXPP-----PPPPXXPXXXXPPPPXXPPP 414 P P PP PPPP PP PP PPPP P PP P P Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PP P PP PP P PP P PP P Sbjct: 252 PPPPPGGLPLPPMPPTGPAPSGPPGPPQLP----PPAPGVHPPAP 292 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ PP P P P PP PPP P PP P PP Sbjct: 260 PLPPM-PPTGPAPSGPPGPPQLPPPAPGV----HPPAPVVHPP 297 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P PP PP P P P PP PP P P Sbjct: 263 PMPPTGPAPSGPPGPPQLPPPAPGVHPPAP-VVHPPASGVHPPAPGVHPPAP 313 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP-----PPPPXXPXXXXPPPPXXPPPXP 408 P PP P PP P PP PP P P PPPP P P Sbjct: 217 PPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P PP PP P P PPP P+ Sbjct: 242 PPRPPLPESLP-PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPV 293 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P P PP P P PP P P PPPP Sbjct: 423 PQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXPXXPPP 415 P P P P PP P P P PP P+ P PP P PP Sbjct: 246 PLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLP-PPAPGVHPP 290 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP P P P P PP PP Sbjct: 255 PPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPP 304 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX-PPXPP---PPPPXXPRXPXPPXPXXPP 418 P P PP P PP PP P PP P P P P PP Sbjct: 233 PPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPP 278 Score = 32.3 bits (70), Expect = 2.4 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPX---PPPPXXPPXP---PPPPPXXPXXXX--PPPPXXPPP 414 P PP PPP P P P PP PP P P PP P PP Sbjct: 275 PGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPP 325 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P P PP P PP PP P P PP P PP P P Sbjct: 310 PPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAP 362 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P P P P P P P PPP + P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAP 377 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P PP P PP PPPPP P P P P Sbjct: 228 PGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 31.9 bits (69), Expect = 3.2 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 P + P PP P P P P PP P P PPP P K Sbjct: 419 PGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPKKKKK 467 Score = 31.5 bits (68), Expect = 4.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXX---PPPXPXXXXKXPFFSXXXFXXXPX 351 PP P P P PP PPP P PP PPP P P P Sbjct: 217 PPAP-PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPP 275 Query: 350 XXXXXPXP 327 P P Sbjct: 276 GPPQLPPP 283 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP PP PP P PP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPP 255 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP PP P PP PP Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P P PP P PP P P P P Sbjct: 254 PPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAP 313 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + PP P PP P P P P P PP P P P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAP 384 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = -3 Query: 507 PPPPXXPPXPP----PPPPXX----PRXPXPPXPXXPPP 415 P PP P PP PPPP PR P P PPP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPP 256 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PP PPPPP P PP Sbjct: 220 PPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPP 266 Score = 30.7 bits (66), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXP--XPPXPXXPPP 415 P P P P P PP P PP P P P PP P PP Sbjct: 318 PAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP 367 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 PP P PP PP P P PP P PP P P Sbjct: 303 PPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAP 348 >BC009903-1|AAH09903.1| 464|Homo sapiens splicing factor 3a, subunit 2, 66kDa protein. Length = 464 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PP P P PPPP PP PP P PP PP PPP P P Sbjct: 242 PPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAP 292 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P P P PP PP PP P P P PP Sbjct: 253 PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPP 297 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP---XXPPXPP-----PPPPXXPXXXXPPPPXXPPP 414 P P PP PPPP PP PP PPPP P PP P P Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PP P PP PP P PP P PP P Sbjct: 252 PPPPPGGLPLPPMPPTGPAPSGPPGPPQLP----PPAPGVHPPAP 292 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ PP P P P PP PPP P PP P PP Sbjct: 260 PLPPM-PPTGPAPSGPPGPPQLPPPAPGV----HPPAPVVHPP 297 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P PP PP P P P PP PP P P Sbjct: 263 PMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVH-PPASGVHPPAPGVHPPAP 313 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP-----PPPPXXPXXXXPPPPXXPPPXP 408 P PP P PP P PP PP P P PPPP P P Sbjct: 217 PPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P PP PP P P PPP P+ Sbjct: 242 PPRPPLPESLP-PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPV 293 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P P PP P P PP P P PPPP Sbjct: 423 PQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXPXXPPP 415 P P P P PP P P P PP P+ P PP P PP Sbjct: 246 PLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLP-PPAPGVHPP 290 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP P P P P PP PP Sbjct: 255 PPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPP 304 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX-PPXPP---PPPPXXPRXPXPPXPXXPP 418 P P PP P PP PP P PP P P P P PP Sbjct: 233 PPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPP 278 Score = 32.3 bits (70), Expect = 2.4 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPX---PPPPXXPPXP---PPPPPXXPXXXX--PPPPXXPPP 414 P PP PPP P P P PP PP P P PP P PP Sbjct: 275 PGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPP 325 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P P PP P PP PP P P PP P PP P P Sbjct: 310 PPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAP 362 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P P P P P P P PPP + P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAP 377 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P PP P PP PPPPP P P P P Sbjct: 228 PGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 31.5 bits (68), Expect = 4.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXX---PPPXPXXXXKXPFFSXXXFXXXPX 351 PP P P P PP PPP P PP PPP P P P Sbjct: 217 PPAP-PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPP 275 Query: 350 XXXXXPXP 327 P P Sbjct: 276 GPPQLPPP 283 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP PP PP P PP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPP 255 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP PP P PP PP Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P P PP P PP P P P P Sbjct: 254 PPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAP 313 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + PP P PP P P P P P PP P P P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAP 384 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + P PP P P P P PP P P PPP P Sbjct: 419 PGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = -3 Query: 507 PPPPXXPPXPP----PPPPXX----PRXPXPPXPXXPPP 415 P PP P PP PPPP PR P P PPP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPP 256 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PP PPPPP P PP Sbjct: 220 PPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPP 266 Score = 30.7 bits (66), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXP--XPPXPXXPPP 415 P P P P P PP P PP P P P PP P PP Sbjct: 318 PAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP 367 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 PP P PP PP P P PP P PP P P Sbjct: 303 PPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAP 348 >BC004434-1|AAH04434.1| 464|Homo sapiens splicing factor 3a, subunit 2, 66kDa protein. Length = 464 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PP P P PPPP PP PP P PP PP PPP P P Sbjct: 242 PPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAP 292 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P P P PP PP PP P P P PP Sbjct: 253 PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPP 297 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP---XXPPXPP-----PPPPXXPXXXXPPPPXXPPP 414 P P PP PPPP PP PP PPPP P PP P P Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PP P PP PP P PP P PP P Sbjct: 252 PPPPPGGLPLPPMPPTGPAPSGPPGPPQLP----PPAPGVHPPAP 292 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ PP P P P PP PPP P PP P PP Sbjct: 260 PLPPM-PPTGPAPSGPPGPPQLPPPAPGV----HPPAPVVHPP 297 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P PP PP P P P PP PP P P Sbjct: 263 PMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVH-PPASGVHPPAPGVHPPAP 313 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP-----PPPPXXPXXXXPPPPXXPPPXP 408 P PP P PP P PP PP P P PPPP P P Sbjct: 217 PPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P PP PP P P PPP P+ Sbjct: 242 PPRPPLPESLP-PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPV 293 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P P PP P P PP P P PPPP Sbjct: 423 PQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXPXXPPP 415 P P P P PP P P P PP P+ P PP P PP Sbjct: 246 PLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLP-PPAPGVHPP 290 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP P P P P PP PP Sbjct: 255 PPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPP 304 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX-PPXPP---PPPPXXPRXPXPPXPXXPP 418 P P PP P PP PP P PP P P P P PP Sbjct: 233 PPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPP 278 Score = 32.3 bits (70), Expect = 2.4 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPX---PPPPXXPPXP---PPPPPXXPXXXX--PPPPXXPPP 414 P PP PPP P P P PP PP P P PP P PP Sbjct: 275 PGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPP 325 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P P PP P PP PP P P PP P PP P P Sbjct: 310 PPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAP 362 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P P P P P P P PPP + P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAP 377 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P PP P PP PPPPP P P P P Sbjct: 228 PGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 31.5 bits (68), Expect = 4.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXX---PPPXPXXXXKXPFFSXXXFXXXPX 351 PP P P P PP PPP P PP PPP P P P Sbjct: 217 PPAP-PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPP 275 Query: 350 XXXXXPXP 327 P P Sbjct: 276 GPPQLPPP 283 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP PP PP P PP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPP 255 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP PP P PP PP Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P P PP P PP P P P P Sbjct: 254 PPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAP 313 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + PP P PP P P P P P PP P P P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAP 384 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + P PP P P P P PP P P PPP P Sbjct: 419 PGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = -3 Query: 507 PPPPXXPPXPP----PPPPXX----PRXPXPPXPXXPPP 415 P PP P PP PPPP PR P P PPP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPP 256 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PP PPPPP P PP Sbjct: 220 PPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPP 266 Score = 30.7 bits (66), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXP--XPPXPXXPPP 415 P P P P P PP P PP P P P PP P PP Sbjct: 318 PAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP 367 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 PP P PP PP P P PP P PP P P Sbjct: 303 PPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAP 348 >AK091050-1|BAC03574.1| 723|Homo sapiens protein ( Homo sapiens cDNA FLJ33731 fis, clone BRAWH2017685, moderately similar to Mus musculus mRNA for nuclear protein ZAP. ). Length = 723 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP--PPXXPXXXXP---PPPXXPPPXP 408 PPP P PPP PP PPP PP P P PPP PP P Sbjct: 96 PPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLP 139 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 8/49 (16%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP+ PPP PPP PP PPP P P PPP PPP Sbjct: 157 PPVLPPPSLFSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPP 205 Score = 39.5 bits (88), Expect = 0.016 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPP--PPXXPPP 414 P P + PP P PPP PP P PPP P PP P PPP Sbjct: 98 PLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPPP 145 Score = 39.5 bits (88), Expect = 0.016 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 10/51 (19%) Frame = -1 Query: 536 PPLXPPPXPX--PPPPXXPPXPPP------PPPXXPXXXXP--PPPXXPPP 414 PP+ PP P PPP PP PP PPP P PPP PPP Sbjct: 113 PPVMPPALPATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPP 163 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = -1 Query: 536 PPLXPPPXPXP-PPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP+ PP P PPP PP PPP P PPP PPP Sbjct: 131 PPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLFSAGPPPVLPPP 177 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP PP PPP P P P P PPP Sbjct: 156 PPPVLPPPSLFSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPP 205 Score = 37.5 bits (83), Expect = 0.065 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPP--PPPXXPXXXXP--PPPXXPP 417 PP+ PP P P PP PPP PPP P PPP PP Sbjct: 104 PPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPPPGMPP 149 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPP--PPPXXPXXXXP--PPPXXPPP 414 PP P P P P PP PP PPP P PPP PPP Sbjct: 87 PPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPP 132 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PP P P PP P P P P P P L Sbjct: 86 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSL 138 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPP PPP P PPP P P Sbjct: 156 PPPVLPPPSLFSAGPPPVLPPPSLSSTAPPPVMPLP 191 Score = 32.3 bits (70), Expect = 2.4 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPP----PPPPXXPXXXXP---PPPXXPPPXP 408 P P L PP PP P PP PPP P P PP P P Sbjct: 170 PPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVP 221 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -1 Query: 503 PPPXXP--PXPPPPPPXXPXXXXP--PPPXXPPPXP 408 PPP P PPP P P P PPP PP P Sbjct: 86 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALP 121 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPPXXXPXPXPP-XPXXXPP 416 P P P P P PPP P P PPP P PP P PP Sbjct: 87 PPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPP 144 Score = 30.7 bits (66), Expect = 7.4 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXP--PPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P PP P P PP PPP PP PP P PP Sbjct: 121 PATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLFSAGPP-PVLPPP 177 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXP---PPPXXPXPPPP--PPXXXPXPXPPXPXXXPPL 413 P P PP P P PP PPP PP PP PPL Sbjct: 143 PPPGMPPSLSSAGPPPVLPPPSLFSAGPPPVLPPPSLSSTAPPPVMPLPPL 193 >AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. Length = 1766 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPP--PPXXPXXXXP---PPPXXPPPXP 408 PPP P PPP PP PPP PP P P PPP PP P Sbjct: 153 PPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLP 196 Score = 44.8 bits (101), Expect = 4e-04 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P+ PP P PPPP PP PPPPP P Sbjct: 1164 PVTRPPVPIPPPPPPPPLPPPPPVIKP 1190 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 8/49 (16%) Frame = -1 Query: 536 PPLXPPPX---PXPPPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP+ PPP PPP PP PPP P P PPP PPP Sbjct: 214 PPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPP 262 Score = 39.5 bits (88), Expect = 0.016 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXP-PPPXXPPXPPP--PPPXXPXXXXPP--PPXXPPP 414 P P + PP P PPP PP P PPP P PP P PPP Sbjct: 155 PLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPPP 202 Score = 39.1 bits (87), Expect = 0.021 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = -1 Query: 536 PPLXPPPXPXP-PPPXXPPX-----PPPPPPXXPXXXXPPPPXXPPP 414 PP+ PP P PPP PP PPP P PPP PPP Sbjct: 188 PPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPP 234 Score = 38.3 bits (85), Expect = 0.037 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -1 Query: 536 PPLXPPPXPXPP--PPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PPP PP PP P PPP PPP PPP Sbjct: 178 PATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPP 220 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPP-----XPPPPPPXXPRXPXPPXPXXPPP 415 P P PP PPP PP PPP P P P P PPP Sbjct: 213 PPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPP 262 Score = 37.5 bits (83), Expect = 0.065 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = -1 Query: 536 PPLXPPPXPXP--PPPXXPPXPPP--PPPXXPXXXXP--PPPXXPP 417 PP+ PP P P PP PPP PPP P PPP PP Sbjct: 161 PPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPPPGMPP 206 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = -1 Query: 542 PXPPLXPPPX----PXPPP-----PXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP+ PP P PP P P P PPP P PPPP P Sbjct: 1140 PPPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPPPVIKP 1190 Score = 36.7 bits (81), Expect = 0.11 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P PP P PP P P PP P PP Sbjct: 1141 PPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPP 1185 Score = 36.3 bits (80), Expect = 0.15 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXP 446 P P P PP PP P PPPPPP P P Sbjct: 1143 PMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPPP 1186 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPP--PPPXXPXXXXP--PPPXXPPP 414 PP P P P P PP PP PPP P PPP PPP Sbjct: 144 PPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPP 189 Score = 35.5 bits (78), Expect = 0.26 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPR 451 PPPP PP PPPPP P+ Sbjct: 1173 PPPPPPPPLPPPPPVIKPQ 1191 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P PP P PP PP PPP P P Sbjct: 1133 PPPGSYRPPPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPP 1184 Score = 34.3 bits (75), Expect = 0.60 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PPP PP P PP P PP P PPP P P Sbjct: 1141 PPPMGKPPGSIVRPSAPPARSSVPVTR-PPVPIPPPPPPPPLPPPP 1185 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXP--PPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PP P P PP P P P P P P L Sbjct: 143 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSL 195 Score = 32.3 bits (70), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP PPP PPP P PPP P P Sbjct: 213 PPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLP 248 Score = 31.9 bits (69), Expect = 3.2 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXP--PPPXXPXPPPP--PPXXXPXPXPPXPXXXPP 416 P P P P PP P P PP PPP PP PP P PP Sbjct: 178 PATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSSAGPP-PVLPPP 234 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -1 Query: 503 PPPXXP--PXPPPPPPXXPXXXXP--PPPXXPPPXP 408 PPP P PPP P P P PPP PP P Sbjct: 143 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALP 178 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPP---PPPXXXPXPXPP-XPXXXPP 416 P P P P P PPP P P PPP P PP P PP Sbjct: 144 PPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPP 201 Score = 30.7 bits (66), Expect = 7.4 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 8/49 (16%) Frame = -1 Query: 536 PPLXPP------PXPXPPPPXXPPXPPPP--PPXXPXXXXPPPPXXPPP 414 PP PP P P PPP PPP PP PPP PP Sbjct: 201 PPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPP 249 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 PP P PP P P PPP P P P P Sbjct: 242 PPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVP 278 Score = 30.3 bits (65), Expect = 9.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXP---PPPXXPXPPPP--PPXXXPXPXPPXPXXXPPL 413 P P PP P P PP PPP PP PP PPL Sbjct: 200 PPPGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLPPL 250 >AC005263-1|AAC25613.1| 464|Homo sapiens SP62_HUMAN protein. Length = 464 Score = 46.8 bits (106), Expect = 1e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPP-PPXXPPPXPXXXXKXP 387 PP P P PPPP PP PP P PP PP PPP P P Sbjct: 242 PPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAP 292 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 542 PXPP---LXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPP 417 P PP PP P P P PP PP PP P P P PP Sbjct: 253 PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPP 297 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP---XXPPXPP-----PPPPXXPXXXXPPPPXXPPP 414 P P PP PPPP PP PP PPPP P PP P P Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP P P PP P PP PP P PP P PP P Sbjct: 252 PPPPPGGLPLPPMPPTGPAPSGPPGPPQLP----PPAPGVHPPAP 292 Score = 38.3 bits (85), Expect = 0.037 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP+ PP P P P PP PPP P PP P PP Sbjct: 260 PLPPM-PPTGPAPSGPPGPPQLPPPAPGV----HPPAPVVHPP 297 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP P P P PP PP P P P PP PP P P Sbjct: 263 PMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVH-PPASGVHPPAPGVHPPAP 313 Score = 36.7 bits (81), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP-----PPPPXXPXXXXPPPPXXPPPXP 408 P PP P PP P PP PP P P PPPP P P Sbjct: 217 PPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 35.5 bits (78), Expect = 0.26 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P PP PP P P PPP P+ Sbjct: 242 PPRPPLPESLP-PPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPV 293 Score = 35.1 bits (77), Expect = 0.34 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 542 PXPPLXPPPXPX--PPPPXXPPXPPPPPPXXPXXXXPPPP 429 P PP P P PP P P PP P P PPPP Sbjct: 423 PQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP-PPXXPRXPXPPXPXXPPP 415 P P P P PP P P P PP P+ P PP P PP Sbjct: 246 PLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLP-PPAPGVHPP 290 Score = 33.1 bits (72), Expect = 1.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P PP P PP P P P P PP PP Sbjct: 255 PPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPP 304 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXX-PPXPP---PPPPXXPRXPXPPXPXXPP 418 P P PP P PP PP P PP P P P P PP Sbjct: 233 PPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPP 278 Score = 32.3 bits (70), Expect = 2.4 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -1 Query: 542 PXPPLXPPPXPX---PPPPXXPPXP---PPPPPXXPXXXX--PPPPXXPPP 414 P PP PPP P P P PP PP P P PP P PP Sbjct: 275 PGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPP 325 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 P P PP P PP PP P P PP P PP P P Sbjct: 310 PPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAP 362 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP P P P P P P P PPP + P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAP 377 Score = 31.9 bits (69), Expect = 3.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXP 419 P PP P PP PPPPP P P P P Sbjct: 228 PGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAP 271 Score = 31.5 bits (68), Expect = 4.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXX---PPPXPXXXXKXPFFSXXXFXXXPX 351 PP P P P PP PPP P PP PPP P P P Sbjct: 217 PPAP-PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPP 275 Query: 350 XXXXXPXP 327 P P Sbjct: 276 GPPQLPPP 283 Score = 31.5 bits (68), Expect = 4.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P PPPP PP PP P PP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPP 255 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P PPPP PP PP P PP PP Sbjct: 221 PSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPP 263 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXPRXPXPPXPXXPPP 415 P P P P PP P P PP P PP P P P P Sbjct: 254 PPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAP 313 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -1 Query: 542 PXPPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P + PP P PP P P P P P PP P P P Sbjct: 332 PAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAP 384 Score = 31.5 bits (68), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 536 PPLXP-PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P + P PP P P P P PP P P PPP P Sbjct: 419 PGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPP 462 Score = 31.1 bits (67), Expect = 5.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = -3 Query: 507 PPPPXXPPXPP----PPPPXX----PRXPXPPXPXXPPP 415 P PP P PP PPPP PR P P PPP Sbjct: 218 PAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPP 256 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P PP P PP PPPPP P PP Sbjct: 220 PPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPP 266 Score = 30.7 bits (66), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXP---PPPPPXXPRXP--XPPXPXXPPP 415 P P P P P PP P PP P P P PP P PP Sbjct: 318 PAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP 367 Score = 30.3 bits (65), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXX-PPPPXXPPPXPXXXXKXP 387 PP P PP PP P P PP P PP P P Sbjct: 303 PPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAP 348 >U36561-1|AAA79948.1| 528|Homo sapiens fus-like protein protein. Length = 528 Score = 46.4 bits (105), Expect = 1e-04 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG G GGGG G GGGG G G RGG G Sbjct: 179 GSGGGGGGGGGG---GSGGGGGYGNQDQSGGGGGGYGQQDRGGRG 220 Score = 43.6 bits (98), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG GGGGG G GG G G GG G Sbjct: 186 GGGGGGSGGGGGYGNQDQSGGGGGGYGQQDRGGRGRGRSSGGGGG 230 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G GGGGGG GG GGG G G + G G Sbjct: 163 GSGGGGSYGQDQSSMSGSGGGGGGGGGGGSGGGGGYGNQDQSGGG 207 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXG--GGGXGXGGGXRGG 537 G G G G GG G GGGG G GG G GG G GG R G Sbjct: 383 GNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAG 427 Score = 42.7 bits (96), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G GGGGGG GG GGGG G G G Sbjct: 166 GGGSYGQDQSSMSGSGGGGGGGGGGGSGGGGGYGNQDQSGGGGGG 210 Score = 40.7 bits (91), Expect = 0.007 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXG-GXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G + GGGGGG G GG G GG G G Sbjct: 189 GGGSGGGGGYGNQDQSGGGGGGYGQQDRGGRGRGRSSGGGGGSGGG 234 Score = 40.3 bits (90), Expect = 0.009 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXG---XXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 G GGG G GG G GGGGGG G GG G G G GG G Sbjct: 184 GGGGGGGGSGGGGGYGNQDQSGGGGGGYGQQDRGGRGRGRSSGGGGGSG 232 Score = 39.5 bits (88), Expect = 0.016 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G G G G G G GGGG GG G GG GGG GG Sbjct: 381 GGGNGRGGRGRGGPMGRGGYGGGGSGG-GGRGGFPSGGGGGGG 422 Score = 38.7 bits (86), Expect = 0.028 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +3 Query: 441 GXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G G G GGGGGG G GGGG G GG G G G Sbjct: 179 GSGGG---GGGGGGGGSGGGGGYGNQDQSGGGGGGYGQQDRG 217 Score = 38.7 bits (86), Expect = 0.028 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 10/55 (18%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXX----------GGGGXGXGGGXRGGXG 543 G GGG GGGG GGGGGG G GGGG GG R G Sbjct: 187 GGGGGSGGGGGYGNQDQSGGGGGGYGQQDRGGRGRGRSSGGGGGSGGGYNRSSGG 241 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXX 557 G G + G G GG G G GGGG G GGG G G G G Sbjct: 165 GGGGSYGQDQSSMSGSGGGGGGGGGGGSGGGGGYGNQDQSGGGGGGYGQQDRGGRGRGRS 224 Query: 558 XXG 566 G Sbjct: 225 SGG 227 Score = 37.5 bits (83), Expect = 0.065 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = +1 Query: 409 GXGGGXXGGG-GXXXXGXXGG----GGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GG G G GG G G GG GG G GGG RGG G Sbjct: 461 GPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFG 510 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG G GG G G GG G GG GG G GG GG G Sbjct: 381 GGGNGRGGRGRGGPMGRGGYGGGG---SGGGGRGGFPSGGGG 419 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXX--GGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GGGGG G GG GG G G Sbjct: 186 GGGGGGSGGGGGYGNQDQSGGGGGGYGQQDRGGRGRGRSSGGGGGSG 232 Score = 34.7 bits (76), Expect = 0.46 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = +1 Query: 409 GXGGGXXGG---GGXXXXGXXGGGGGGXGG--XXGGG----GXGXGGGXRGGXG 543 G GGG G GG GGGGG GG GG G G G G RGG G Sbjct: 205 GGGGGGYGQQDRGGRGRGRSSGGGGGSGGGYNRSSGGYEPRGRGGGRGGRGGMG 258 Score = 34.3 bits (75), Expect = 0.60 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G G G G GGGG GG GG GG G Sbjct: 383 GNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAG 427 Score = 34.3 bits (75), Expect = 0.60 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGG 480 +G G GGG GGGG GGGGGG Sbjct: 391 RGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGG 422 Score = 33.5 bits (73), Expect = 1.1 Identities = 23/70 (32%), Positives = 25/70 (35%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G + +G GGG G GG G G GG GG G Sbjct: 197 GYGNQDQSGGGGGGYGQQDRGGRGRGRSSGGGG-GSGGGYNRSSGGYEPRGRGGGRGGRG 255 Query: 508 XGXGGGXRGG 537 G GG RGG Sbjct: 256 -GMGGSDRGG 264 Score = 31.5 bits (68), Expect = 4.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 438 GGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G GGGGG G G GG G G G G Sbjct: 217 GGRGRGRSSGGGGGSGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFG 269 Score = 30.7 bits (66), Expect = 7.4 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXG-XGGXGXGXXXGGGGGGXGXXGGG 503 G+ G RGG G GG G G GGGGG G G Sbjct: 385 GRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAG 427 >M10938-1|AAA36153.1| 493|Homo sapiens protein ( Human epidermal 67-kDa type II keratin mRNA. ). Length = 493 Score = 46.4 bits (105), Expect = 1e-04 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXG--GGGXXXXGXXGGGGGGXGGXXGGGGXGXG--GGXRGGXG 543 G GGG G G G G GG GGG GG GG G G G GG GG G Sbjct: 418 GGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSSGGRG 466 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG--GGXGXGGGXRGG 537 G GGG G G GG GG GG GG GG G GGG GG Sbjct: 416 GSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGG 460 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 +G G GG G GG G GGGGGG G GG GG G G Sbjct: 367 RGGGGGGYGSGGSSYGSGG-CSYGSGGGGGGGRGSYGSGGSSYGSGGSSYGSG 418 Score = 39.5 bits (88), Expect = 0.016 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG--------GGXRGGXG 543 G GGG GG G G G GG GGGG G G GG RGG G Sbjct: 389 GSGGGGGGGRGSYGSGGSSYGSGGSSYGSGGGGGGHGSYGSGSSSGGYRGGSG 441 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGGG G GG G GGGG G GG G G Sbjct: 412 GSSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGG 456 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGG G G GGG GG GG G GG G Sbjct: 438 GGSGGGGGGSSGGRGSGGGSSGGSSGGRGSSSGGVKSSG 476 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG------GGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG GGGG G G GG G GGG GG G Sbjct: 402 GSGGSSYGSGGSSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRG 452 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G G GGGG G G GG G GGGG G G GG Sbjct: 363 GGGSRGGGGGGYGSGGSSYGSGGCSYGSGGGGGGGRGSYGSGG 405 Score = 37.5 bits (83), Expect = 0.065 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXG-GXXGGGGXGXGGGXRGGXG 543 GGG GGGG G G GG G G G G GGG RG G Sbjct: 363 GGGSRGGGG----GGYGSGGSSYGSGGCSYGSGGGGGGGRGSYG 402 Score = 35.1 bits (77), Expect = 0.34 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GG G GGGG GG G G G G Sbjct: 418 GGGGGGHGSYGSGSSSGGYRGGSGG-GGGGSSGGRGSGGGSSGGSSGGRGSSSGGVKSSG 476 Score = 34.3 bits (75), Expect = 0.60 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 440 GXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G RG GGG G G G GG GG G G Sbjct: 363 GGGSRGGGGGGYGSGGSSYGSGGCSYGSGGGGGGGRG 399 Score = 34.3 bits (75), Expect = 0.60 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G GG G G G G G GG G GG G G G G Sbjct: 411 GGSSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSSGGRGSSSG 470 Score = 33.9 bits (74), Expect = 0.80 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 GG GG G G GG G G GG GG G G G Sbjct: 434 GGYRGGSGGGGGGSSGGRGSG-GGSSGGSSGGRGSSSGG 471 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXG---GXXGGGGXGXGGGXRGGXG 543 GG GGGG G G GG G GGGG G G G Sbjct: 364 GGSRGGGGGGYGSGGSSYGSGGCSYGSGGGGGGGRGSYGSGGSSYG 409 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXG 578 GG G G G G G GG GGGG G G G G G Sbjct: 392 GGGGGGRGSYGSGGSSYGSGGSSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGG 445 Score = 31.5 bits (68), Expect = 4.2 Identities = 23/95 (24%), Positives = 25/95 (26%) Frame = +3 Query: 282 GXXGXGGXKNXXXKXGXWXXXXXXGXXXKXXXGKKGXFXXXXXXRGGXXXGXGGXGXGXX 461 G G G + G G + G G G G GG G Sbjct: 370 GGGGYGSGGSSYGSGGCSYGSGGGGGGGRGSYGSGGSSYGSGGSSYGSGGGGGGHGSYGS 429 Query: 462 XGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G GGGG G G G G Sbjct: 430 GSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSSGG 464 Score = 31.5 bits (68), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGG 536 RGG G GG G GGG G G G GG Sbjct: 437 RGGSGGGGGGSSGGRGSGGGSSGGSSGGRGSSSGGVKSSGG 477 Score = 31.1 bits (67), Expect = 5.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 409 GXGGGXXGG---GGXXXXGXXGGGGGGXGGXXGGGG 507 G GGG GG GG G GG G GG GG Sbjct: 442 GGGGGSSGGRGSGGGSSGGSSGGRGSSSGGVKSSGG 477 >BC150273-1|AAI50274.1| 1422|Homo sapiens YEATS domain containing 2 protein. Length = 1422 Score = 46.4 bits (105), Expect = 1e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GGGGGG G GGG G GGG GG Sbjct: 794 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAGG 832 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG GG G G GG GGGG GGG + G Sbjct: 802 GAGGGGGGGGG-------GGSGSGGGGSTGGGGGTAGGGTQSTAG 839 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGGG GG GG G G GG GG G Sbjct: 794 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGG 828 Score = 39.9 bits (89), Expect = 0.012 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +2 Query: 431 GXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G GGGGGG GG G GG GG G G Sbjct: 794 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAGGG 833 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G G GGGG G G GGGG G GGGG GG Sbjct: 800 GSGAGGGGGGGGGGGSGSGGGGSTG--GGGGTAGGG 833 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 GG G GG G G GGG G GG GGG GG Sbjct: 804 GGGGGGGGGGGSGSGGGGSTGGGGGTAGGGTQSTAGPGG 842 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGG G GGGGG G G GG Sbjct: 805 GGGGGGGGGGSGSGGGGSTGGGGGTAGGGTQSTAGPGG 842 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GG G G G GGG G G G Sbjct: 802 GAGGGGGGGGGGGSGSGGGGSTGGGGGTAGGGTQSTAGPG 841 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GG G G GGGG G GG G G G Sbjct: 794 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAG 831 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G G G GGGG G G G G G Sbjct: 799 GGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAGG 832 >BC003413-1|AAH03413.1| 217|Homo sapiens nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) protein. Length = 217 Score = 46.4 bits (105), Expect = 1e-04 Identities = 23/42 (54%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGG 537 GGG G GG G GGG GGG G GGGG G GG GG Sbjct: 170 GGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGG 211 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGG GGG GG GG G GGG RGG G Sbjct: 163 GEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRG 209 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/51 (45%), Positives = 24/51 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 +G G GG GG G GGGGGG G GG G GGG RGG Sbjct: 8 RGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGG-RGG 57 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 409 GXGGGXXGGG-GXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGG GGG G G GGGGGG G GGG G G Sbjct: 179 GRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRG 216 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GG GG GG GG G GGG RG Sbjct: 175 GRGGGRGGGG--RGGGRGGGFRGGRGGGGGGFRGGRGGGFRG 214 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 RGG G GG G G G GGG G GGGG G GG G G Sbjct: 173 RGGRGGGRGGGGRGG--GRGGGFRGGRGGGGGGFRGGRGGGFRGRG 216 Score = 38.7 bits (86), Expect = 0.028 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GG GGGG GG RGG G Sbjct: 6 GGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFG 50 Score = 37.1 bits (82), Expect = 0.085 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GGG GG GGGGGG GG GGG GG G Sbjct: 16 GGGGFNRGGSSNH-FRGGGGGGGGGNFRGGGRGGFGRGGGRGG 57 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 RG GGG G G GGGGG GG GG GG G Sbjct: 4 RGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRG 56 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 GGG GGGG GGG GG G G GG G Sbjct: 31 GGGGGGGGG----NFRGGGRGGFGRGGGRGGFNKG 61 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 RGG G GG G GG GGGG G GG G G Sbjct: 8 RGGFNRGGGGGGFNR---GGSSNHFRGGGGGGGGGNFRGGGRGGFG 50 Score = 30.3 bits (65), Expect = 9.8 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 7/62 (11%) Frame = +3 Query: 414 RGGXXXGX--GGXGXGXXXGGG-----GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXX 572 RGG G GG G G GG GGG G GG G G G G G Sbjct: 4 RGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQD 63 Query: 573 XG 578 G Sbjct: 64 QG 65 >AJ276003-1|CAB76563.1| 217|Homo sapiens GAR1 protein protein. Length = 217 Score = 46.4 bits (105), Expect = 1e-04 Identities = 23/42 (54%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGG 537 GGG G GG G GGG GGG G GGGG G GG GG Sbjct: 170 GGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGG 211 Score = 46.0 bits (104), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG--GGGXGGXXGGGGXGXGGGXRGGXG 543 G G GGG G GGG GGG GG GG G GGG RGG G Sbjct: 163 GEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRG 209 Score = 43.6 bits (98), Expect = 0.001 Identities = 23/51 (45%), Positives = 24/51 (47%) Frame = +1 Query: 385 KGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 +G G GG GG G GGGGGG G GG G GGG RGG Sbjct: 8 RGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGG-RGG 57 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 409 GXGGGXXGGG-GXXXXGXXGGGGGGXGGXXGGGGXGXG 519 G GGG GGG G G GGGGGG G GGG G G Sbjct: 179 GRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRG 216 Score = 41.9 bits (94), Expect = 0.003 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRG 534 G GGG GGG G GG GG GG GG G GGG RG Sbjct: 175 GRGGGRGGGG--RGGGRGGGFRGGRGGGGGGFRGGRGGGFRG 214 Score = 41.5 bits (93), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 RGG G GG G G G GGG G GGGG G GG G G Sbjct: 173 RGGRGGGRGGGGRGG--GRGGGFRGGRGGGGGGFRGGRGGGFRGRG 216 Score = 38.7 bits (86), Expect = 0.028 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G GG GGGG GG RGG G Sbjct: 6 GGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFG 50 Score = 37.1 bits (82), Expect = 0.085 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 GGG GG GGGGGG GG GGG GG G Sbjct: 16 GGGGFNRGGSSNH-FRGGGGGGGGGNFRGGGRGGFGRGGGRGG 57 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 386 RGVXXXXXXXGGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXG 544 RG GGG G G GGGGG GG GG GG G Sbjct: 4 RGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRG 56 Score = 32.3 bits (70), Expect = 2.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXG 519 GGG GGGG GGG GG G G GG G Sbjct: 31 GGGGGGGGG----NFRGGGRGGFGRGGGRGGFNKG 61 Score = 31.9 bits (69), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 RGG G GG G GG GGGG G GG G G Sbjct: 8 RGGFNRGGGGGGFNR---GGSSNHFRGGGGGGGGGNFRGGGRGGFG 50 Score = 30.3 bits (65), Expect = 9.8 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 7/62 (11%) Frame = +3 Query: 414 RGGXXXGX--GGXGXGXXXGGG-----GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXX 572 RGG G GG G G GG GGG G GG G G G G G Sbjct: 4 RGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQD 63 Query: 573 XG 578 G Sbjct: 64 QG 65 >AB033023-1|BAA86511.1| 1487|Homo sapiens KIAA1197 protein protein. Length = 1487 Score = 46.4 bits (105), Expect = 1e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GGGGGG G GGG G GGG GG Sbjct: 859 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAGG 897 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGGG GG G G GG GGGG GGG + G Sbjct: 867 GAGGGGGGGGG-------GGSGSGGGGSTGGGGGTAGGGTQSTAG 904 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 439 GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GGGG GG GG G G GG GG G Sbjct: 859 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGG 893 Score = 39.9 bits (89), Expect = 0.012 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +2 Query: 431 GXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G GGGGGG GG G GG GG G G Sbjct: 859 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAGGG 898 Score = 39.5 bits (88), Expect = 0.016 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G G GGGG G G GGGG G GGGG GG Sbjct: 865 GSGAGGGGGGGGGGGSGSGGGGSTG--GGGGTAGGG 898 Score = 39.5 bits (88), Expect = 0.016 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGG 535 GG G GG G G GGG G GG GGG GG Sbjct: 869 GGGGGGGGGGGSGSGGGGSTGGGGGTAGGGTQSTAGPGG 907 Score = 36.3 bits (80), Expect = 0.15 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GGG G GGGGG G G GG Sbjct: 870 GGGGGGGGGGSGSGGGGSTGGGGGTAGGGTQSTAGPGG 907 Score = 33.5 bits (73), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 432 GXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 G GG G G GG G G G GGG G G G Sbjct: 867 GAGGGGGGGGGGGSGSGGGGSTGGGGGTAGGGTQSTAGPG 906 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 453 GXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 G GG G G GGGG G GG G G G Sbjct: 859 GSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAG 896 Score = 31.1 bits (67), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 465 GGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 GG G G G GGGG G G G G G Sbjct: 864 GGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAGG 897 >U16371-1|AAB60346.1| 31|Homo sapiens androgen receptor protein. Length = 31 Score = 46.0 bits (104), Expect = 2e-04 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGGGG GG GGGG G GGG GG Sbjct: 1 GPCGGGGGGGGGGGGGGGGGGGGGGGGG 28 Score = 44.4 bits (100), Expect = 6e-04 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +1 Query: 454 GXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGGGGG GG GGGG G GGG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGEAG 31 Score = 43.2 bits (97), Expect = 0.001 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGGGG GG GGGG G GGG G G Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGEAG 31 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/34 (58%), Positives = 20/34 (58%) Frame = +1 Query: 421 GXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGGG G GGGGGG GG GGGG G G Sbjct: 1 GPCGGGGG---GGGGGGGGGGGGGGGGGGGGEAG 31 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +1 Query: 469 GGGGXGGXXGGGGXGXGGGXRGGXG 543 GGGG GG GGGG G GGG GG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGG 28 Score = 40.7 bits (91), Expect = 0.007 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXG 498 GGG GGGG G GGGGGG GG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGEAG 31 Score = 39.5 bits (88), Expect = 0.016 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +1 Query: 463 GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG GGGG G GGG GG G Sbjct: 1 GPCGGGGGGGGGGGGGGGGGGGGGGGG 27 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGG 501 G GG GGGG G GGGGGG GG G Sbjct: 1 GPCGGGGGGGGGGGGGGGGGGGGGGGGGEAG 31 Score = 39.1 bits (87), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGGGGGXGXXGGGGXG 512 G G GG G G GGGGGG G GGG G Sbjct: 1 GPCGGGGGGGGGGGGGGGGGGGGGGGGGEAG 31 Score = 31.9 bits (69), Expect = 3.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 468 GGGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GGGGG G GGGG G GG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGEAG 31 >M99061-1|AAC83410.1| 645|Homo sapiens epidermal cytokeratin 2 protein. Length = 645 Score = 46.0 bits (104), Expect = 2e-04 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GGG G GG GGG G GGG GG G Sbjct: 91 GRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGG--GFGGGRFGGFG 133 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGG---GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G G G GGG GG GGG G GGG G Sbjct: 559 GGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGG 606 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GGG G GG G G G GGG GG Sbjct: 84 GAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGG 126 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G G GGG GG GGG G G GG G Sbjct: 95 GFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVG 139 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGG GG GG G G G GG G Sbjct: 101 GFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPG 145 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXX-GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GGG G GG GGG G GG GG G Sbjct: 78 GGGGGFGAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGG 123 Score = 41.5 bits (93), Expect = 0.004 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G G G GG GGG G G GGG GG G GG Sbjct: 526 GSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGY--GSGGGSGGRYGSGG 583 Query: 508 XGXGGGXRGG 537 GG GG Sbjct: 584 GSKGGSISGG 593 Score = 41.1 bits (92), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GG GGG G GGG GG GGG G GGG Sbjct: 587 GGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSGGG 623 Score = 40.7 bits (91), Expect = 0.007 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GGG G GG G G GG G G G G G Sbjct: 79 GGGGFGAAG-GFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGG 137 Score = 40.7 bits (91), Expect = 0.007 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G GGG GGG G GG G G G GG G Sbjct: 103 GGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFG 148 Score = 40.3 bits (90), Expect = 0.009 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GGG G GG G G GG G G Sbjct: 573 GGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGG 617 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG-GGGGGXGGXXGGGGXGXGG 522 G GG GGGG G GG GG GG G GG G GG Sbjct: 113 GFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGG 151 Score = 39.5 bits (88), Expect = 0.016 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G GG G GG G GG G GG GG G Sbjct: 80 GGGFGAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFG 125 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGX-XGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGG G GG GG GG G GG G GG G Sbjct: 107 GFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPG 150 Score = 37.9 bits (84), Expect = 0.049 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG---------GGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG GGGG G GG GG GG GG G GGG GG G Sbjct: 47 GGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSG 101 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G GG GG GG GGG G GGG G G Sbjct: 541 GSSSYGSGGRQSGSRGGSGG--GGSISGGGYGSGGGSGGRYG 580 Score = 36.3 bits (80), Expect = 0.15 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGX---GGXXGGGG-XGXGGGXRGG 537 GG GGG G GG GG GG GGG GGG RGG Sbjct: 567 GGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGG 611 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G RG GG GGG G G G GG G G Sbjct: 80 GGGFGAAGGFGGRG--GGFGGGSGFGGGSGFGGGSGFSGGGFGGG 122 Score = 35.9 bits (79), Expect = 0.20 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G G G G GGG G GG G GG G G G G Sbjct: 84 GAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGG 143 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXG-GXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GGG G G GGG GG G G Sbjct: 97 GGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLG 142 Score = 35.1 bits (77), Expect = 0.34 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXX-GGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GGGG G G G GG GG G G Sbjct: 103 GGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFG 148 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G G G GGG GG GGG G G G G G Sbjct: 555 RGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSG 605 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGG--XXGGGGXXXXXXXGGXXGXG 550 GG G GG G GGG G GG GGG GG G G Sbjct: 576 GGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSG 621 Score = 33.9 bits (74), Expect = 0.80 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGG----GXGXXGGGGXGXXXXXXGGXXG 545 G +G G G GG G G GGG G G GGG G GG G Sbjct: 528 GGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKG 587 Query: 546 XGXXXXGXXXG 578 G G Sbjct: 588 GSISGGGYGSG 598 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGG--GGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GG G GG GGG GG G G Sbjct: 536 GGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSG 582 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GG G GGG G GG G G Sbjct: 596 GSGGGKHSSGGGSRGGSSSGGGYGSGGGGSSSVKGSSG 633 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 12/57 (21%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXG------------GGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G R G GGGGG G G GG G G G Sbjct: 49 GGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSGFGGG 105 Score = 31.9 bits (69), Expect = 3.2 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGG-GXGXXXXXXGGXXGXGX 554 G +G GG GG G GGG G GGG G G GG G Sbjct: 553 GSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGS 612 Query: 555 XXXG 566 G Sbjct: 613 SSGG 616 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 437 GGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G RG GGG G G G GG G G Sbjct: 525 GGSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGG 562 >AJ628418-1|CAF31522.1| 600|Homo sapiens keratin 3 protein. Length = 600 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG G G GGG G GGG G GGG GG Sbjct: 509 GYGGGYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGG 551 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 409 GXGGGXXGG---GGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG GG G GGGGG GG GGG G GG Sbjct: 517 GMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGG 558 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG G G G GGG G GG G GG G GG G G Sbjct: 64 GYGGGFGSGYGGGFGGGFGGGRGMGGGFGGAGGFGGAGGFGGAGG 108 Score = 44.0 bits (99), Expect = 7e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGG--GXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GG GG G GG G GG G GG GG G Sbjct: 80 GFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGGF-GGPG 125 Score = 43.6 bits (98), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GG GG GG G GG G GG G G Sbjct: 76 GFGGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGG 120 Score = 43.6 bits (98), Expect = 0.001 Identities = 24/49 (48%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGG--GXRGGXG 543 G GGG G GG G GG G GG GG G GG G G G GG G Sbjct: 86 GMGGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFG 134 Score = 42.3 bits (95), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG GGG GG GG G GG G GG G G Sbjct: 72 GYGGGF--GGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGPGG 114 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GGG GG G G G GGG GG G Sbjct: 508 GGYGGGYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFG 549 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGG--GXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G G GG GG G GG G GG G G G Sbjct: 88 GGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFG 134 Score = 41.1 bits (92), Expect = 0.005 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGG--GGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG GG G G G G G GG GGG G G GG G Sbjct: 513 GYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSG 560 Score = 40.3 bits (90), Expect = 0.009 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GGG GG G GG G G G GG G Sbjct: 63 GGYGGGFGSGYGGGFGGGFGGGRGMGGGFGGAGGFGGAGGFG 104 Score = 39.9 bits (89), Expect = 0.012 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G RG GGG GG GG G GG GG G G Sbjct: 74 GGGFGGGFGGGRGM-GGGFGGAGGFGGAGGFGGAGGFGGPGGFG 116 Score = 38.3 bits (85), Expect = 0.037 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 415 GGGXXGG--GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG GG GG GGG G GGG G GG RG G Sbjct: 45 GGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGG 89 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G G GGG G GG G GG GG G G Sbjct: 66 GGGFGSGYGGGFGGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFG 110 Score = 37.9 bits (84), Expect = 0.049 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G G G GG GG GG G GG GG G G Sbjct: 78 GGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGGFG 122 Score = 37.9 bits (84), Expect = 0.049 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGG 537 GGG G G G GGG GGG G GG G G G R G Sbjct: 529 GGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYG 570 Score = 37.1 bits (82), Expect = 0.085 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGG--GXXXXGXXGGGGGGXGGXXGGG-GXGXGGGXRGGXG 543 G GGG G G G GGG GG GGG G G G G GG G Sbjct: 51 GFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFGGAGGFG 98 Score = 37.1 bits (82), Expect = 0.085 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG--GGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GG G GG GG G G G GG G Sbjct: 92 GGAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPG 136 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GGG G G GGG G GG G Sbjct: 512 GGYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSG 554 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGG-GGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G G GG GGG G GG G G G G G Sbjct: 530 GGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVSGGG 575 Score = 33.1 bits (72), Expect = 1.4 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +3 Query: 438 GGXGXGXXXGGGGG-GXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G GGG G G GGG G GG G G G G G Sbjct: 508 GGYGGGYGGGMGGGLGGGFSAGGGSG-SGFGRGGGGGIGGGFGGGSSGFSGGSG 560 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG-GGG-GGXGGXXGGGGXGXGG 522 G GG G GG G G GG GG G GG G GG Sbjct: 98 GGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGG 137 Score = 31.5 bits (68), Expect = 4.2 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXG-GXXGGGGXXXXXXXGGXXG 544 GG G GG G G GG GG G G G G GG G Sbjct: 98 GGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPG 140 Score = 30.3 bits (65), Expect = 9.8 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G GG GGG G GGG G G G G G G Sbjct: 63 GGYGGGFGSGYGGGFGGGFGGGRGM--GGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGG 120 >AF019084-1|AAB81946.1| 645|Homo sapiens keratin 2e protein. Length = 645 Score = 46.0 bits (104), Expect = 2e-04 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GGG G GG GGG G GGG GG G Sbjct: 91 GRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGG--GFGGGRFGGFG 133 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 409 GXGGGXXGGG---GXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG GGG G G G GGG GG GGG G GGG G Sbjct: 559 GGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGG 606 Score = 44.4 bits (100), Expect = 6e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GG G GG G GGG G GG G G G GGG GG Sbjct: 84 GAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGG 126 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G G GGG GG GGG G G GG G Sbjct: 95 GFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVG 139 Score = 43.2 bits (97), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GGG G GGGG GG GG G G G GG G Sbjct: 101 GFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPG 145 Score = 42.7 bits (96), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXX-GGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GGG GG G GGG G GG GGG G GG GG G Sbjct: 78 GGGGGFGAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGG 123 Score = 41.5 bits (93), Expect = 0.004 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = +1 Query: 328 GXGXXXXXXGXXXKXXXEKKGXXXXXXGXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGG 507 G G G G G GG GGG G G GGG GG G GG Sbjct: 526 GSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGY--GSGGGSGGRYGSGG 583 Query: 508 XGXGGGXRGG 537 GG GG Sbjct: 584 GSKGGSISGG 593 Score = 41.1 bits (92), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 GG GGG G GGG GG GGG G GGG Sbjct: 587 GGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSGGG 623 Score = 40.7 bits (91), Expect = 0.007 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G G GG GGG G GG G G GG G G G G G Sbjct: 79 GGGGFGAAG-GFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGG 137 Score = 40.7 bits (91), Expect = 0.007 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G GGG GGG G GG G G G GG G Sbjct: 103 GGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFG 148 Score = 40.3 bits (90), Expect = 0.009 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G GG G GG G GGG G GG G G GG G G Sbjct: 573 GGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGG 617 Score = 39.9 bits (89), Expect = 0.012 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXG-GGGGGXGGXXGGGGXGXGG 522 G GG GGGG G GG GG GG G GG G GG Sbjct: 113 GFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGG 151 Score = 39.5 bits (88), Expect = 0.016 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG-GGXGGXXGGGGXGXGGGXRGGXG 543 G G G GG G G GG G GG G GG G GG GG G Sbjct: 80 GGGFGAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFG 125 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGX-XGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GGG G GG GG GG G GG G GG G Sbjct: 107 GFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPG 150 Score = 37.9 bits (84), Expect = 0.049 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGG---------GGXGGXXGGGG-XGXGGGXRGGXG 543 G GGG GGGG G GG GG GG GG G GGG GG G Sbjct: 47 GGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSG 101 Score = 36.3 bits (80), Expect = 0.15 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 G G G G GG GG GG GGG G GGG G G Sbjct: 541 GSSSYGSGGRQSGSRGGSGG--GGSISGGGYGSGGGSGGRYG 580 Score = 36.3 bits (80), Expect = 0.15 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGGGGGX---GGXXGGGG-XGXGGGXRGG 537 GG GGG G GG GG GG GGG GGG RGG Sbjct: 567 GGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGG 611 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G RG GG GGG G G G GG G G Sbjct: 80 GGGFGAAGGFGGRG--GGFGGGSGFGGGSGFGGGSGFSGGGFGGG 122 Score = 35.9 bits (79), Expect = 0.20 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +3 Query: 420 GXXXGXGGXGXGXXXGGG-GGGXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 G G GG G G G G GGG G GG G GG G G G G Sbjct: 84 GAAGGFGGRGGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGG 143 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGGGGGGXG-GXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G G GGG G G GGG GG G G Sbjct: 97 GGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLG 142 Score = 35.1 bits (77), Expect = 0.34 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXX-GGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG GG G G GGGG G G G GG GG G G Sbjct: 103 GGGSGFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFG 148 Score = 35.1 bits (77), Expect = 0.34 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 414 RGGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXGXGXXXXG 566 RGG G G G GGG GG GGG G G G G G Sbjct: 555 RGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSG 605 Score = 34.7 bits (76), Expect = 0.46 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 419 GGXXGXGGXGXRGXXGGGGGGXGG--XXGGGGXXXXXXXGGXXGXG 550 GG G GG G GGG G GG GGG GG G G Sbjct: 576 GGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSG 621 Score = 33.9 bits (74), Expect = 0.80 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGG----GXGXXGGGGXGXXXXXXGGXXG 545 G +G G G GG G G GGG G G GGG G GG G Sbjct: 528 GGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKG 587 Query: 546 XGXXXXGXXXG 578 G G Sbjct: 588 GSISGGGYGSG 598 Score = 32.3 bits (70), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXGG--GGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G G G G GG G GG GGG GG G G Sbjct: 536 GGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSG 582 Score = 32.3 bits (70), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGG 522 G GGG GG G GGG G GG G G Sbjct: 596 GSGGGKHSSGGGSRGGSSSGGGYGSGGGGSSSVKGSSG 633 Score = 31.9 bits (69), Expect = 3.2 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 12/57 (21%) Frame = +2 Query: 416 GGGXXGXGGXGXRGXXG------------GGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GGG G GG G R G GGGGG G G GG G G G Sbjct: 49 GGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSGFGGG 105 Score = 31.9 bits (69), Expect = 3.2 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +3 Query: 378 GKKGXFXXXXXXRGGXXXGXGGXGXGXXXGGGGGGXGXXGGG-GXGXXXXXXGGXXGXGX 554 G +G GG GG G GGG G GGG G G GG G Sbjct: 553 GSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGS 612 Query: 555 XXXG 566 G Sbjct: 613 SSGG 616 Score = 30.7 bits (66), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 437 GGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 GG G RG GGG G G G GG G G Sbjct: 525 GGSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGG 562 >AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. Length = 1682 Score = 46.0 bits (104), Expect = 2e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 524 PPPXPXPPPPXXPPXPPPPPPXXPXXXXPP 435 PP P PPPP PP PPPPPP PP Sbjct: 244 PPGLPLPPPPLPPPPPPPPPPLPGLATSPP 273 Score = 40.3 bits (90), Expect = 0.009 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P P L PPP PP P PPPPPP P Sbjct: 771 PPPALPPPPPLAKFPPPSQPQPPPPPPPSP 800 Score = 39.5 bits (88), Expect = 0.016 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 PPPP PP PPPPPP PP P Sbjct: 250 PPPPLPPPPPPPPPPLPGLATSPPFQLTKP 279 Score = 38.3 bits (85), Expect = 0.037 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXP 477 P PL PPP P PPPP PP P Sbjct: 245 PGLPLPPPPLPPPPPPPPPPLP 266 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXPF 384 PP P PPP P PPPP PPP P PF Sbjct: 244 PPGLPLPPPPLP----PPPPPPPPPLPGLATSPPF 274 Score = 37.9 bits (84), Expect = 0.049 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 PPP P PPPP P P PP PPP P K Sbjct: 771 PPPALP--PPPPLAKFPPPSQPQPPPPPPPSPASLLK 805 Score = 36.7 bits (81), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 521 PPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 PP PPPP PPP P P PPPP P Sbjct: 771 PPPALPPPPPLAKFPPPSQPQPP----PPPPPSP 800 Score = 36.3 bits (80), Expect = 0.15 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -3 Query: 504 PPPXXPPXPPP---PPPXXPRXPXPPXP 430 PPP PP PP PPP P+ P PP P Sbjct: 771 PPPALPPPPPLAKFPPPSQPQPPPPPPP 798 Score = 35.5 bits (78), Expect = 0.26 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 511 PXPPPPXXPXPP-PPPPXXXPXPXPPXPXXXPPL 413 P PPPP P PP PPPP PP P L Sbjct: 248 PLPPPPLPPPPPPPPPPLPGLATSPPFQLTKPGL 281 Score = 34.7 bits (76), Expect = 0.46 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPP 466 P P PP PPP P PPPPP Sbjct: 771 PPPALPPPPPLAKFPPPSQPQPPPPPPP 798 Score = 34.3 bits (75), Expect = 0.60 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 PP PP P PPPP P P P PP Sbjct: 244 PPGLPLPPPPLPPPPPPPPPPLPGLATSPP 273 Score = 33.5 bits (73), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP 465 P PP PP P PPPP P PP Sbjct: 248 PLPPPPLPPPPPPPPPPLPGLATSPP 273 Score = 31.1 bits (67), Expect = 5.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P L P P PPPP PPPPP Sbjct: 457 PHLSLPPGPSSPPPPPCPRLLRPPPPP 483 Score = 30.3 bits (65), Expect = 9.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PP P PP PP P P PPPP Sbjct: 453 PAATPHLSLPPGPSSPPPPPCPRLLRP----PPPP 483 >AF305687-1|AAG22558.1| 282|Homo sapiens transcription factor ATFx protein. Length = 282 Score = 36.7 bits (81), Expect(2) = 2e-04 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXP 453 L PP P P PP PP P PP P P Sbjct: 117 LDAPPLPPPSPPPLPPPPLPPAPSLP 142 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPL PP P PPP PP P P P P PP Sbjct: 120 PPLPPPSPPPLPPPPLPP-APSLPLSLPSFDLPQPP 154 Score = 36.3 bits (80), Expect = 0.15 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXP 421 PP PPP PP P P PP P P Sbjct: 120 PPLPPPSPPPLPPPPLPPAPSLP 142 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP PP PPPP P P P P P Sbjct: 120 PPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPP 154 Score = 34.7 bits (76), Expect(2) = 0.017 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PPP PP P PP P P P P Sbjct: 120 PPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQP 153 Score = 32.7 bits (71), Expect = 1.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PP PP P P PP+ Sbjct: 123 PPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPV 155 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP 465 PPL PP P PP P P P P Sbjct: 178 PPLPPPQQPPPPSPPQPSRLAPYP 201 Score = 28.3 bits (60), Expect(2) = 2e-04 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P PP P P P Sbjct: 178 PPLPPPQQPPPPSPPQPSRLAPYP 201 Score = 23.8 bits (49), Expect(2) = 0.017 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPP 462 P P PP P P P PP Sbjct: 78 PLEPPLPPGTLPQPSPTPP 96 >AB021663-1|BAA78477.2| 282|Homo sapiens leucine-zipper protein protein. Length = 282 Score = 36.7 bits (81), Expect(2) = 2e-04 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPPXXP 453 L PP P P PP PP P PP P P Sbjct: 117 LDAPPLPPPSPPPLPPPPLPPAPSLP 142 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 PPL PP P PPP PP P P P P PP Sbjct: 120 PPLPPPSPPPLPPPPLPP-APSLPLSLPSFDLPQPP 154 Score = 36.3 bits (80), Expect = 0.15 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 489 PPXPPPPPPXXPRXPXPPXPXXP 421 PP PPP PP P P PP P P Sbjct: 120 PPLPPPSPPPLPPPPLPPAPSLP 142 Score = 35.1 bits (77), Expect = 0.34 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PPP PP PPPP P P P P P Sbjct: 120 PPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPP 154 Score = 34.7 bits (76), Expect(2) = 0.017 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 PP PPP PP P PP P P P P Sbjct: 120 PPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQP 153 Score = 32.7 bits (71), Expect = 1.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 511 PXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPPL 413 P P PP P PP PP P P PP+ Sbjct: 123 PPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPV 155 Score = 30.3 bits (65), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPP 465 PPL PP P PP P P P P Sbjct: 178 PPLPPPQQPPPPSPPQPSRLAPYP 201 Score = 28.3 bits (60), Expect(2) = 2e-04 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 479 PPPPPPXXPXXXXPPPPXXPPPXP 408 PP PPP P PP P P P Sbjct: 178 PPLPPPQQPPPPSPPQPSRLAPYP 201 Score = 23.8 bits (49), Expect(2) = 0.017 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPP 462 P P PP P P P PP Sbjct: 78 PLEPPLPPGTLPQPSPTPP 96 >X05421-1|CAA28996.1| 233|Homo sapiens keratin type II protein. Length = 233 Score = 45.6 bits (103), Expect = 2e-04 Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 409 GXGGGXXGG-GGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGG 537 G GGG GG GG G GGG G G GGGG G GGG GG Sbjct: 142 GYGGGYGGGMGGGLGGGFSAGGGSGIGFGRGGGG-GIGGGFGGG 184 Score = 44.0 bits (99), Expect = 7e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 409 GXGGGXXGG---GGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GGG GG GG G GGGGG GG GGG G GG Sbjct: 150 GMGGGLGGGFSAGGGSGIGFGRGGGGGIGGGFGGGTSGFSGG 191 Score = 40.3 bits (90), Expect = 0.009 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 418 GGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGGXRGGXG 543 GG GG G G GGG GG G G G GGG GG G Sbjct: 141 GGYGGGYGGGMGGGLGGGFSAGGGSGIGFGRGGGGGIGGGFG 182 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGGGGXGXXXXXXGGXXG 545 GG G GG G GGG G G GGG G GG G Sbjct: 145 GGYGGGMGGGLGGGFSAGGGSGIGFGRGGGGGIGGGFGGGTSG 187 Score = 36.3 bits (80), Expect = 0.15 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 415 GGGXXGGGGXXXXGXXGGG-GGGXGGXXGGGGXGXGGGXRGG 537 GGG G G G GGG GGG G GG G G G R G Sbjct: 162 GGGSGIGFGRGGGGGIGGGFGGGTSGFSGGSGFGSISGARYG 203 Score = 33.9 bits (74), Expect = 0.80 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGG-GGGGXGXXGGGGXGXXXXXXGGXXGXG 551 GG G G G G GG GGG G GG G G G G G Sbjct: 163 GGSGIGFGRGGGGGIGGGFGGGTSGFSGGSGFGSISGARYGVSGGG 208 Score = 33.1 bits (72), Expect = 1.4 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +3 Query: 438 GGXGXGXXXGGGGG-GXGXXGGGGXGXXXXXXGGXXGXGXXXXGXXXGXXXXXG 596 GG G G G GGG G G GGG G GG G G G G G Sbjct: 141 GGYGGGYGGGMGGGLGGGFSAGGGSG-IGFGRGGGGGIGGGFGGGTSGFSGGSG 193 Score = 30.7 bits (66), Expect = 7.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 431 GXGGXGXRGXXGGGGGGXGGXXGGGGXXXXXXXGGXXGXG 550 G G G G GGG GG GG G GG G G Sbjct: 141 GGYGGGYGGGMGGGLGGGFSAGGGSGIGFGRGGGGGIGGG 180 Score = 30.3 bits (65), Expect = 9.8 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGG--XGGXXG-GGGXGXGGGXRGG 537 G GGG GG G G GG G G G G GG RGG Sbjct: 172 GGGGGIGGGFGGGTSGFSGGSGFGSISGARYGVSGGGFSSASNRGG 217 >M60858-1|AAA59954.1| 707|Homo sapiens nucleolin protein. Length = 707 Score = 45.6 bits (103), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG--GXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG GG G G G GG G GG RGG G Sbjct: 646 GEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRG 692 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG GGG G GG G G G GG G GGG Sbjct: 656 GRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGG 694 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG---GGXGXXXXXXGGXXGXG 551 GG GG G GGG GG G GG GG G GG G G Sbjct: 648 GGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGG 695 >BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein protein. Length = 270 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PL PP P PPP PP PPPPPP Sbjct: 42 PPLPLEMPPPPPPPPESPPPPPPPPPP 68 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P P PPPPPP P PPPP PPP Sbjct: 38 PVLQPPLPLEMPPPPPPPPESP----PPPPPPPPP 68 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 536 PPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P L PP P PPPP PP PPPPP PPPP Sbjct: 38 PVLQPPLPLEMPPPPPPPPESPPPPP------PPPPP 68 Score = 40.7 bits (91), Expect = 0.007 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPP 462 + PPP P PPPP PP P PPP Sbjct: 240 IEPPPPPPPPPPPPPPAPKMPPP 262 Score = 39.9 bits (89), Expect = 0.012 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP 439 PPPP PP PPPPPP P+ P P Sbjct: 242 PPPP--PPPPPPPPPPAPKMPPP 262 Score = 37.1 bits (82), Expect = 0.085 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P PPPP P PPPPPP P Sbjct: 38 PVLQPPLPLEMPPPPPPPPESPPPPPPPPP 67 Score = 37.1 bits (82), Expect = 0.085 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 477 PPPPPXXPRXPXPPXPXXPPP 415 PPPPP P P PP P PPP Sbjct: 242 PPPPPPPPPPPPPPAPKMPPP 262 Score = 36.7 bits (81), Expect = 0.11 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPP 471 P PPP P PPPP P PPP Sbjct: 242 PPPPPPPPPPPPPPAPKMPPP 262 Score = 35.9 bits (79), Expect = 0.20 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P + PP P PPPP PP P PP Sbjct: 235 PTATIIEPPPPPPPPPPPPPPAPKMPP 261 Score = 35.5 bits (78), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPP 432 PP PP PPPPPP P PPP Sbjct: 242 PP--PPPPPPPPPPPPAPKMPPP 262 Score = 35.1 bits (77), Expect = 0.34 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P PPPP P PPPP P P Sbjct: 235 PTATIIEPPPPPPPPPPPPPPAPKMPP 261 Score = 34.3 bits (75), Expect = 0.60 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPP 414 PPPPP P PP P PPP Sbjct: 242 PPPPPPPPPPPPPPAPKMPPP 262 Score = 34.3 bits (75), Expect = 0.60 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPP 429 PP PPPPPP P PPP Sbjct: 243 PPPPPPPPPPPPPAPKMPPP 262 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 P L P P PPPPPP P PPPP P P K Sbjct: 223 PSLQPVQARGAVPTATIIEPPPPPPPPPP---PPPPAPKMPPPEKTKK 267 >BC111697-1|AAI11698.1| 983|Homo sapiens RBM26 protein protein. Length = 983 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PP PP PPP PP PPP P Sbjct: 341 PPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLP 385 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP--XXPPXPPPP--PPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P L PPP PPP PP PPP PP P PPPP PP P P Sbjct: 342 PPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPP-LPPLQPSGMDAPP 396 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPPP PP PP PPP PPP PP P P Sbjct: 332 PAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPP 382 Score = 37.9 bits (84), Expect = 0.049 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP--PPXXPRXPXPPXPXXP 421 P P PP PP PP PPP PP P PP P P Sbjct: 342 PPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPP 386 Score = 35.5 bits (78), Expect = 0.26 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPP---PPXXPPPXP 408 P P PP P PP PP P PP P PPP P Sbjct: 330 PFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGP 369 Score = 33.9 bits (74), Expect = 0.80 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXP-PXPXXXPPLXXXXXXNXPFFP 377 P P PP P PP P PPP P P P P P PP+ P P Sbjct: 330 PFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPPLQP 389 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P PP P PPP P P PP PP Sbjct: 326 PGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPL--PPSLPPVTGPPPP 383 Query: 415 L 413 L Sbjct: 384 L 384 Score = 32.7 bits (71), Expect = 1.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P P PPP P PP P P PP Sbjct: 344 PGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPP 386 Score = 31.5 bits (68), Expect = 4.2 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPP---PPPXXPRXPXPPXPXX 424 P P P PP PPP PP PP PPP P P P Sbjct: 336 PVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLP--PLQPSGMD 393 Query: 423 PPP 415 PP Sbjct: 394 APP 396 >BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 45.6 bits (103), Expect = 2e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P PPP P PPPP P PPPPPP Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPP 30 Score = 42.3 bits (95), Expect = 0.002 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP PPPPP P PPPP P P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PPPP PP PP P P P PPPP Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPP----PPPP 30 Score = 38.7 bits (86), Expect = 0.028 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P PP PPPPP P+ PP P P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 38.7 bits (86), Expect = 0.028 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P PP PP P P P PP PPP P P Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 Score = 38.3 bits (85), Expect = 0.037 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P PP PPPPPP P PP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPP 30 Score = 36.3 bits (80), Expect = 0.15 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P PPPP P P PP P P Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP PP PPPPPP P PPP P P Sbjct: 5 PQPQPP--PPAPPPPPPQ--------PQPQPPPPPPGPGAGP 36 Score = 32.3 bits (70), Expect = 2.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P PP P P PP PPP P P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 >BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 45.6 bits (103), Expect = 2e-04 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPP 462 P PPP P PPPP P PPPPPP Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPP 30 Score = 42.3 bits (95), Expect = 0.002 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 503 PPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P P PP PPPPP P PPPP P P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 Score = 41.5 bits (93), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P P PPPP PP PP P P P PPPP Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPP----PPPP 30 Score = 38.7 bits (86), Expect = 0.028 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 504 PPPXXPPXPPPPPPXXPRXPXPPXPXXP 421 P P PP PPPPP P+ PP P P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 38.7 bits (86), Expect = 0.028 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXP 453 P PP PP P P P PP PPP P P Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 Score = 38.3 bits (85), Expect = 0.037 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXP 430 P P PP PPPPPP P PP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPP 30 Score = 36.3 bits (80), Expect = 0.15 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXPPXPXXPP 418 P PP P PPPP P P PP P P Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 Score = 33.9 bits (74), Expect = 0.80 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 512 PXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P PP PP PPPPPP P PPP P P Sbjct: 5 PQPQPP--PPAPPPPPPQ--------PQPQPPPPPPGPGAGP 36 Score = 32.3 bits (70), Expect = 2.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P PP P P PP PPP P P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36 >BC041655-1|AAH41655.1| 980|Homo sapiens RNA binding motif protein 26 protein. Length = 980 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXP 408 P PP PPP P PP PP PPP PP PPP P Sbjct: 341 PPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLP 385 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPP--XXPPXPPPP--PPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P P L PPP PPP PP PPP PP P PPPP PP P P Sbjct: 342 PPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPP-LPPLQPSGMDAPP 396 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPP--PPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PP PPPP PP PP PPP PPP PP P P Sbjct: 332 PAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPP 382 Score = 37.9 bits (84), Expect = 0.049 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 549 PXPXXPPXXXXXXXPPPPXXPPXPPPP--PPXXPRXPXPPXPXXP 421 P P PP PP PP PPP PP P PP P P Sbjct: 342 PPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPP 386 Score = 35.5 bits (78), Expect = 0.26 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPP---PPXXPPPXP 408 P P PP P PP PP P PP P PPP P Sbjct: 330 PFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGP 369 Score = 33.9 bits (74), Expect = 0.80 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = -2 Query: 550 PXPXXPPXXXXXXPXPPPPXXPX-PPPPPPXXXPXPXP-PXPXXXPPLXXXXXXNXPFFP 377 P P PP P PP P PPP P P P P P PP+ P P Sbjct: 330 PFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPPLQP 389 Score = 32.7 bits (71), Expect = 1.8 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 595 PXXXXXPXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPPXPXXXPP 416 P P P P P P PP P PPP P P PP PP Sbjct: 326 PGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPL--PPSLPPVTGPPPP 383 Query: 415 L 413 L Sbjct: 384 L 384 Score = 32.7 bits (71), Expect = 1.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 565 PXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPPPXXXPXPXPP 437 P P P P P PPP P PP P P PP Sbjct: 344 PGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPP 386 Score = 31.5 bits (68), Expect = 4.2 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = -3 Query: 594 PXXXXXPXXXXXXXXPXPXXPPXXXXXXXPPPPXXPPXPPP---PPPXXPRXPXPPXPXX 424 P P P PP PPP PP PP PPP P P P Sbjct: 336 PVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLP--PLQPSGMD 393 Query: 423 PPP 415 PP Sbjct: 394 APP 396 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P PL PP P PPP PP PPPPPP Sbjct: 703 PPLPLEMPPPPPPPPESPPPPPPPPPP 729 Score = 44.0 bits (99), Expect = 7e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 518 PXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPP 414 P PP P P PPPPPP P PPPP PPP Sbjct: 699 PVLQPPLPLEMPPPPPPPPESP----PPPPPPPPP 729 Score = 41.9 bits (94), Expect = 0.003 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 536 PPLXPP-PXPXPPPPXXPPXPPPPPPXXPXXXXPPPP 429 P L PP P PPPP PP PPPPP PPPP Sbjct: 699 PVLQPPLPLEMPPPPPPPPESPPPPP------PPPPP 729 Score = 40.7 bits (91), Expect = 0.007 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 530 LXPPPXPXPPPPXXPPXPPPPPP 462 + PPP P PPPP PP P PPP Sbjct: 901 IEPPPPPPPPPPPPPPAPKMPPP 923 Score = 39.9 bits (89), Expect = 0.012 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 507 PPPPXXPPXPPPPPPXXPRXPXP 439 PPPP PP PPPPPP P+ P P Sbjct: 903 PPPP--PPPPPPPPPPAPKMPPP 923 Score = 37.1 bits (82), Expect = 0.085 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXPPXPPPPPPXXP 454 P P PPPP P PPPPPP P Sbjct: 699 PVLQPPLPLEMPPPPPPPPESPPPPPPPPP 728 Score = 37.1 bits (82), Expect = 0.085 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 477 PPPPPXXPRXPXPPXPXXPPP 415 PPPPP P P PP P PPP Sbjct: 903 PPPPPPPPPPPPPPAPKMPPP 923 Score = 36.7 bits (81), Expect = 0.11 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPP 471 P PPP P PPPP P PPP Sbjct: 903 PPPPPPPPPPPPPPAPKMPPP 923 Score = 35.9 bits (79), Expect = 0.20 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPP 462 P + PP P PPPP PP P PP Sbjct: 896 PTATIIEPPPPPPPPPPPPPPAPKMPP 922 Score = 35.5 bits (78), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 500 PPXXPPXPPPPPPXXPXXXXPPP 432 PP PP PPPPPP P PPP Sbjct: 903 PP--PPPPPPPPPPPPAPKMPPP 923 Score = 35.1 bits (77), Expect = 0.34 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 532 PXXXXXXPXPPPPXXPXPPPPPPXXXP 452 P P PPPP P PPPP P P Sbjct: 896 PTATIIEPPPPPPPPPPPPPPAPKMPP 922 Score = 34.3 bits (75), Expect = 0.60 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 476 PPPPPXXPXXXXPPPPXXPPP 414 PPPPP P PP P PPP Sbjct: 903 PPPPPPPPPPPPPPAPKMPPP 923 Score = 34.3 bits (75), Expect = 0.60 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 488 PPXPPPPPPXXPXXXXPPPP 429 PP PPPPPP P PPP Sbjct: 904 PPPPPPPPPPPPPAPKMPPP 923 Score = 32.7 bits (71), Expect = 1.8 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXK 393 P L P P PPPPPP P PPPP P P K Sbjct: 884 PSLQPVQARGAVPTATIIEPPPPPPPPPP---PPPPAPKMPPPEKTKK 928 >BC006516-1|AAH06516.3| 482|Homo sapiens NCL protein protein. Length = 482 Score = 45.6 bits (103), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG--GXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG GG G G G GG G GG RGG G Sbjct: 421 GEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRG 467 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG GGG G GG G G G GG G GGG Sbjct: 431 GRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGG 469 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG---GGXGXXXXXXGGXXGXG 551 GG GG G GGG GG G GG GG G GG G G Sbjct: 423 GGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGG 470 >BC006494-1|AAH06494.3| 482|Homo sapiens NCL protein protein. Length = 482 Score = 45.6 bits (103), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG--GXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG GG G G G GG G GG RGG G Sbjct: 421 GEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRG 467 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG GGG G GG G G G GG G GGG Sbjct: 431 GRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGG 469 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG---GGXGXXXXXXGGXXGXG 551 GG GG G GGG GG G GG GG G GG G G Sbjct: 423 GGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGG 470 >BC002343-1|AAH02343.3| 482|Homo sapiens NCL protein protein. Length = 482 Score = 45.6 bits (103), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXG--GXXGGGGXGXGGGXRGGXG 543 G GG GGG G GGG GG G G G GG G GG RGG G Sbjct: 421 GEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRG 467 Score = 35.1 bits (77), Expect = 0.34 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 409 GXGGGXXGGGGXXXXGXXGGGGGGXGGXXGGGGXGXGGG 525 G GG GGG G GG G G G GG G GGG Sbjct: 431 GRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGG 469 Score = 34.7 bits (76), Expect = 0.46 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 417 GGXXXGXGGXGXGXXXGGGGGGXGXXGG---GGXGXXXXXXGGXXGXG 551 GG GG G GGG GG G GG GG G GG G G Sbjct: 423 GGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGG 470 >AL646016-1|CAI17009.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1120 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1177 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1131 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1188 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1142 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1199 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1153 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1210 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1164 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1221 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1175 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1232 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1186 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1243 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1197 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPP 1254 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1208 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1265 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1219 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1276 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1230 PPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1287 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1241 PPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPP 1298 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1252 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPP 1309 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1263 PPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1320 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1274 PPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPP 1331 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1285 PPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1342 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1296 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1353 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 9/61 (14%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKX 390 P PPL PPP P PPPP P PPPP P PP P P P P Sbjct: 1318 PPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPP 1377 Query: 389 P 387 P Sbjct: 1378 P 1378 Score = 45.2 bits (102), Expect = 3e-04 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 PP PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1119 PP--PPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1166 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP------PXXPPXPP---PPPPXXPXXXXPPPPXXP----PPXP 408 P PPL P PPP P PP P PPPP P PPPP P PP P Sbjct: 1087 PPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1144 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP---PXXPPXPP------PPPPXXPXXXXPPPPXXP----PPXP 408 P PPL P PPP PP PP PPPP P PPPP P PP P Sbjct: 1098 PPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1155 Score = 43.2 bits (97), Expect = 0.001 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP----XXPPPXP 408 P PP P PPPP PPPPP PPPP PPP P Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1156 Score = 42.7 bits (96), Expect = 0.002 Identities = 30/68 (44%), Positives = 30/68 (44%), Gaps = 16/68 (23%) Frame = -1 Query: 542 PXPPLX----PPPXPXP----PPPXXPPXP----PPPPPXXPXXXXPPPPXXP----PPX 411 P PPL PPP P P PPP PP P PPPPP P PPPP P PP Sbjct: 1307 PPPPLPGAGIPPPPPLPGVGIPPP--PPLPGVGIPPPPPL-PGAGIPPPPPLPGMGIPPA 1363 Query: 410 PXXXXKXP 387 P P Sbjct: 1364 PAPPLPPP 1371 Score = 41.9 bits (94), Expect = 0.003 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 1/97 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXX 401 P P P PP P PPP P PPPPP P P P PP Sbjct: 1317 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPP--GTG 1374 Query: 400 XXNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXP 290 P P L P + F PP P Sbjct: 1375 IPPPPLLPVSGPPLLPQVGSSTLPTPQVCGFLPPPLP 1411 Score = 41.1 bits (92), Expect = 0.005 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP------PXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPL P PPP PPPPP P P PPP PP P P Sbjct: 1329 PPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGP 1386 Score = 40.7 bits (91), Expect = 0.007 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXP 408 P PPL P PPP PPPPP PPP PPP P Sbjct: 1076 PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPP 1123 Score = 40.3 bits (90), Expect = 0.009 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P L P PPP PPPPP P PPPP P Sbjct: 1032 PTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLP 1070 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP---XXPPPXP 408 P PPL PP PPPP P PP P P P PPP P Sbjct: 1364 PAPPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLPTPQVCGFLPPPLP 1411 Score = 39.1 bits (87), Expect = 0.021 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1086 PPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1141 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1097 PPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1152 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1163 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1119 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1174 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1130 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1185 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1141 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1196 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1152 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1207 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1163 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1218 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1174 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1229 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1185 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1240 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1196 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIP 1251 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1207 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIP 1262 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1218 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIP 1273 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1229 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1284 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1240 PPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIP 1295 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1251 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIP 1306 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1262 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIP 1317 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1273 PPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIP 1328 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1284 PPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIP 1339 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1295 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIP 1350 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1306 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIP 1361 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = -1 Query: 533 PLXPPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPP P PPPP P P P P PPPP P PP P Sbjct: 1052 PPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPP 1100 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXPXXXXKXP 387 P PP P P PP PPPPP PPPP PPP P P Sbjct: 1064 PPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPP 1121 Score = 36.7 bits (81), Expect = 0.11 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 9/97 (9%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPX---PPPPP-PXXXPXPXPPXP----XXXPPLXXXXXXNX 389 P PP PPPP P PPPPP P P PP P PPL Sbjct: 1040 PQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPP 1099 Query: 388 PFFPXXFFXL-XPFXXXXSXXPXXXXXFFXPPXPXXP 281 P P L P P PP P P Sbjct: 1100 PPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLP 1136 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP----XXPPPXPXXXXKXP 387 P P P PPPP PPPPP P PP PPP P P Sbjct: 1042 PPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIP 1097 Score = 36.3 bits (80), Expect = 0.15 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP-PXXXPXPXPPXPXXXPPL 413 P P P P P P PP P PPPPP P P PP P PL Sbjct: 1055 PPPLPGAGIPPPPPLPGAGIL-PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPL 1109 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P P PP P P P P PPP PL Sbjct: 1052 PPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPL 1109 Score = 34.7 bits (76), Expect = 0.46 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P P P P PP PPP PPP P P Sbjct: 1020 PPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPP--PPPLPGAGIPPP 1066 >AL590490-1|CAH70931.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1120 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1177 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1131 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1188 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1142 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1199 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1153 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1210 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1164 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1221 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1175 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1232 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1186 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1243 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1197 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPP 1254 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1208 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1265 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1219 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1276 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1230 PPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1287 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1241 PPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPP 1298 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1252 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPP 1309 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1263 PPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1320 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1274 PPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPP 1331 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1285 PPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1342 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1296 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1353 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 9/61 (14%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKX 390 P PPL PPP P PPPP P PPPP P PP P P P P Sbjct: 1318 PPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPP 1377 Query: 389 P 387 P Sbjct: 1378 P 1378 Score = 45.2 bits (102), Expect = 3e-04 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 PP PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1119 PP--PPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1166 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP------PXXPPXPP---PPPPXXPXXXXPPPPXXP----PPXP 408 P PPL P PPP P PP P PPPP P PPPP P PP P Sbjct: 1087 PPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1144 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP---PXXPPXPP------PPPPXXPXXXXPPPPXXP----PPXP 408 P PPL P PPP PP PP PPPP P PPPP P PP P Sbjct: 1098 PPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1155 Score = 43.2 bits (97), Expect = 0.001 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP----XXPPPXP 408 P PP P PPPP PPPPP PPPP PPP P Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1156 Score = 42.7 bits (96), Expect = 0.002 Identities = 30/68 (44%), Positives = 30/68 (44%), Gaps = 16/68 (23%) Frame = -1 Query: 542 PXPPLX----PPPXPXP----PPPXXPPXP----PPPPPXXPXXXXPPPPXXP----PPX 411 P PPL PPP P P PPP PP P PPPPP P PPPP P PP Sbjct: 1307 PPPPLPGAGIPPPPPLPGVGIPPP--PPLPGVGIPPPPPL-PGAGIPPPPPLPGMGIPPA 1363 Query: 410 PXXXXKXP 387 P P Sbjct: 1364 PAPPLPPP 1371 Score = 41.9 bits (94), Expect = 0.003 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 1/97 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXX 401 P P P PP P PPP P PPPPP P P P PP Sbjct: 1317 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPP--GTG 1374 Query: 400 XXNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXP 290 P P L P + F PP P Sbjct: 1375 IPPPPLLPVSGPPLLPQVGSSTLPTPQVCGFLPPPLP 1411 Score = 41.1 bits (92), Expect = 0.005 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP------PXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPL P PPP PPPPP P P PPP PP P P Sbjct: 1329 PPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGP 1386 Score = 40.7 bits (91), Expect = 0.007 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXP 408 P PPL P PPP PPPPP PPP PPP P Sbjct: 1076 PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPP 1123 Score = 40.3 bits (90), Expect = 0.009 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P L P PPP PPPPP P PPPP P Sbjct: 1032 PTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLP 1070 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP---XXPPPXP 408 P PPL PP PPPP P PP P P P PPP P Sbjct: 1364 PAPPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLPTPQVCGFLPPPLP 1411 Score = 39.1 bits (87), Expect = 0.021 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1086 PPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1141 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1097 PPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1152 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1163 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1119 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1174 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1130 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1185 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1141 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1196 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1152 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1207 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1163 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1218 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1174 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1229 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1185 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1240 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1196 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIP 1251 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1207 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIP 1262 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1218 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIP 1273 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1229 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1284 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1240 PPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIP 1295 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1251 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIP 1306 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1262 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIP 1317 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1273 PPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIP 1328 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1284 PPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIP 1339 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1295 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIP 1350 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1306 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIP 1361 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = -1 Query: 533 PLXPPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPP P PPPP P P P P PPPP P PP P Sbjct: 1052 PPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPP 1100 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXPXXXXKXP 387 P PP P P PP PPPPP PPPP PPP P P Sbjct: 1064 PPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPP 1121 Score = 36.7 bits (81), Expect = 0.11 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 9/97 (9%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPX---PPPPP-PXXXPXPXPPXP----XXXPPLXXXXXXNX 389 P PP PPPP P PPPPP P P PP P PPL Sbjct: 1040 PQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPP 1099 Query: 388 PFFPXXFFXL-XPFXXXXSXXPXXXXXFFXPPXPXXP 281 P P L P P PP P P Sbjct: 1100 PPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLP 1136 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP----XXPPPXPXXXXKXP 387 P P P PPPP PPPPP P PP PPP P P Sbjct: 1042 PPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIP 1097 Score = 36.3 bits (80), Expect = 0.15 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP-PXXXPXPXPPXPXXXPPL 413 P P P P P P PP P PPPPP P P PP P PL Sbjct: 1055 PPPLPGAGIPPPPPLPGAGIL-PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPL 1109 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P P PP P P P P PPP PL Sbjct: 1052 PPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPL 1109 Score = 34.7 bits (76), Expect = 0.46 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P P P P PP PPP PPP P P Sbjct: 1020 PPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPP--PPPLPGAGIPPP 1066 >AL513342-1|CAI17121.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1120 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1177 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1131 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1188 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1142 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1199 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1153 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1210 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1164 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1221 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1175 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1232 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1186 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1243 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1197 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPP 1254 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1208 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1265 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1219 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1276 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1230 PPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1287 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1241 PPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPP 1298 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1252 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPP 1309 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1263 PPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1320 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1274 PPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPP 1331 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1285 PPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1342 Score = 45.6 bits (103), Expect = 2e-04 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPL PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1296 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1353 Score = 45.6 bits (103), Expect = 2e-04 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 9/61 (14%) Frame = -1 Query: 542 PXPPLX------PPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKX 390 P PPL PPP P PPPP P PPPP P PP P P P P Sbjct: 1318 PPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPP 1377 Query: 389 P 387 P Sbjct: 1378 P 1378 Score = 45.2 bits (102), Expect = 3e-04 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = -1 Query: 536 PPLXPPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 PP PPP P PPPP P PPPP P PPPP P PP P Sbjct: 1119 PP--PPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1166 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP------PXXPPXPP---PPPPXXPXXXXPPPPXXP----PPXP 408 P PPL P PPP P PP P PPPP P PPPP P PP P Sbjct: 1087 PPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1144 Score = 43.2 bits (97), Expect = 0.001 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 13/58 (22%) Frame = -1 Query: 542 PXPPLXPPPXPXPPP---PXXPPXPP------PPPPXXPXXXXPPPPXXP----PPXP 408 P PPL P PPP PP PP PPPP P PPPP P PP P Sbjct: 1098 PPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1155 Score = 43.2 bits (97), Expect = 0.001 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP----XXPPPXP 408 P PP P PPPP PPPPP PPPP PPP P Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1156 Score = 42.7 bits (96), Expect = 0.002 Identities = 30/68 (44%), Positives = 30/68 (44%), Gaps = 16/68 (23%) Frame = -1 Query: 542 PXPPLX----PPPXPXP----PPPXXPPXP----PPPPPXXPXXXXPPPPXXP----PPX 411 P PPL PPP P P PPP PP P PPPPP P PPPP P PP Sbjct: 1307 PPPPLPGAGIPPPPPLPGVGIPPP--PPLPGVGIPPPPPL-PGAGIPPPPPLPGMGIPPA 1363 Query: 410 PXXXXKXP 387 P P Sbjct: 1364 PAPPLPPP 1371 Score = 41.9 bits (94), Expect = 0.003 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 1/97 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPPPXXXPXPXPPXPXXXPPLXXXX 401 P P P PP P PPP P PPPPP P P P PP Sbjct: 1317 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPP--GTG 1374 Query: 400 XXNXPFFPXXFFXLXPFXXXXSXXPXXXXXFFXPPXP 290 P P L P + F PP P Sbjct: 1375 IPPPPLLPVSGPPLLPQVGSSTLPTPQVCGFLPPPLP 1411 Score = 41.1 bits (92), Expect = 0.005 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPP------PXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPL P PPP PPPPP P P PPP PP P P Sbjct: 1329 PPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGP 1386 Score = 40.7 bits (91), Expect = 0.007 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPP---PXXPPPXP 408 P PPL P PPP PPPPP PPP PPP P Sbjct: 1076 PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPP 1123 Score = 40.3 bits (90), Expect = 0.009 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 536 PPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXP 420 P L P PPP PPPPP P PPPP P Sbjct: 1032 PTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLP 1070 Score = 39.5 bits (88), Expect = 0.016 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP---XXPPPXP 408 P PPL PP PPPP P PP P P P PPP P Sbjct: 1364 PAPPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLPTPQVCGFLPPPLP 1411 Score = 39.1 bits (87), Expect = 0.021 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1086 PPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1141 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1097 PPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1152 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1163 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1119 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1174 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1130 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1185 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1141 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1196 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1152 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1207 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1163 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1218 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1174 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1229 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1185 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1240 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1196 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIP 1251 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1207 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIP 1262 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1218 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIP 1273 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1229 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1284 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1240 PPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIP 1295 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1251 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIP 1306 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1262 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIP 1317 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1273 PPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIP 1328 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1284 PPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIP 1339 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1295 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIP 1350 Score = 38.7 bits (86), Expect = 0.028 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPP-PXXPXPPPPP-PXXXPXPXPPXPXXXPP 416 P P P PP P PPP P PPPPP P P PP P P Sbjct: 1306 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIP 1361 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = -1 Query: 533 PLXPPPXPX---PPPPXXPPXPPPPPPXXPXXXXPPPPXXP----PPXP 408 P PPP P PPPP P P P P PPPP P PP P Sbjct: 1052 PPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPP 1100 Score = 37.9 bits (84), Expect = 0.049 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP------XXPPPXPXXXXKXP 387 P PP P P PP PPPPP PPPP PPP P P Sbjct: 1064 PPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPP 1121 Score = 36.7 bits (81), Expect = 0.11 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 9/97 (9%) Frame = -2 Query: 544 PXXPPXXXXXXPXPPPPXXPX---PPPPP-PXXXPXPXPPXP----XXXPPLXXXXXXNX 389 P PP PPPP P PPPPP P P PP P PPL Sbjct: 1040 PQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPP 1099 Query: 388 PFFPXXFFXL-XPFXXXXSXXPXXXXXFFXPPXPXXP 281 P P L P P PP P P Sbjct: 1100 PPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLP 1136 Score = 36.7 bits (81), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = -1 Query: 542 PXPPLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPP----XXPPPXPXXXXKXP 387 P P P PPPP PPPPP P PP PPP P P Sbjct: 1042 PPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIP 1097 Score = 36.3 bits (80), Expect = 0.15 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 577 PXXXPXXXXPXPXXPPXXXXXXPXPPPPXXPXPPPPP-PXXXPXPXPPXPXXXPPL 413 P P P P P P PP P PPPPP P P PP P PL Sbjct: 1055 PPPLPGAGIPPPPPLPGAGIL-PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPL 1109 Score = 35.9 bits (79), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = -3 Query: 543 PXXPPXXXXXXXPPPPXXP-----PXPPPPPPXXPRXPXPPXPXXPPPXXXXXXXTPL 385 P PP PPPP P P PP P P P P PPP PL Sbjct: 1052 PPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPL 1109 Score = 34.7 bits (76), Expect = 0.46 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 533 PLXPPPXPXPPPPXXPPXPPPPPPXXPXXXXPPPPXXPPPXPXXXXKXP 387 P PPP P P P P PP PPP PPP P P Sbjct: 1020 PPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPP--PPPLPGAGIPPP 1066 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.310 0.155 0.525 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,658,250 Number of Sequences: 237096 Number of extensions: 3288615 Number of successful extensions: 280408 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 11812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90229 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11437206932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -