BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K06 (1303 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119125-1|AAM50985.1| 553|Drosophila melanogaster RE28286p pro... 36 0.092 AE014298-1861|AAF48238.3| 625|Drosophila melanogaster CG12723-P... 36 0.092 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 34 0.49 >AY119125-1|AAM50985.1| 553|Drosophila melanogaster RE28286p protein. Length = 553 Score = 36.3 bits (80), Expect = 0.092 Identities = 22/73 (30%), Positives = 26/73 (35%) Frame = +1 Query: 1081 SXPRTPKYPPXSXXPXWXPXTXXPXTPDTXPPIRXXVXPXLXXXXHXPGQXSNPAXPXLP 1260 S P P+ P P + P TP PP R V + P S PA P P Sbjct: 412 STPVRPESGTGIASPQIPPQSPEPETPSEVPPQRPSVQQPWKPVFYSPPTESAPASPNRP 471 Query: 1261 XXXLYPPPXKKPS 1299 L PP P+ Sbjct: 472 SITLLPPYGSAPA 484 >AE014298-1861|AAF48238.3| 625|Drosophila melanogaster CG12723-PA protein. Length = 625 Score = 36.3 bits (80), Expect = 0.092 Identities = 22/73 (30%), Positives = 26/73 (35%) Frame = +1 Query: 1081 SXPRTPKYPPXSXXPXWXPXTXXPXTPDTXPPIRXXVXPXLXXXXHXPGQXSNPAXPXLP 1260 S P P+ P P + P TP PP R V + P S PA P P Sbjct: 484 STPVRPESGTGIASPQIPPQSPEPETPSEVPPQRPSVQQPWKPVFYSPPTESAPASPNRP 543 Query: 1261 XXXLYPPPXKKPS 1299 L PP P+ Sbjct: 544 SITLLPPYGSAPA 556 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 33.9 bits (74), Expect = 0.49 Identities = 27/103 (26%), Positives = 31/103 (30%) Frame = +1 Query: 991 PXNXXLPPXPLXXXXRSTTRSXXRXXHAATSXPRTPKYPPXSXXPXWXPXTXXPXTPDTX 1170 P N LPP + R+T R T P T PP P P P T Sbjct: 484 PTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPP---PPTRPPTK 540 Query: 1171 PPIRXXVXPXLXXXXHXPGQXSNPAXPXLPXXXLYPPPXKKPS 1299 PP + P P P P PPP + S Sbjct: 541 PPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPPTRAS 583 Score = 30.7 bits (66), Expect = 4.6 Identities = 27/98 (27%), Positives = 35/98 (35%) Frame = +1 Query: 991 PXNXXLPPXPLXXXXRSTTRSXXRXXHAATSXPRTPKYPPXSXXPXWXPXTXXPXTPDTX 1170 P N LPP + R+T R+ R T R P PP + P T P P T Sbjct: 798 PTNKPLPPVTV----RTTVRTTPRPTLPPT---RPPTKPPTTYLPPPTVRTTRPPPPPTR 850 Query: 1171 PPIRXXVXPXLXXXXHXPGQXSNPAXPXLPXXXLYPPP 1284 PP + P + + P P +Y PP Sbjct: 851 PPTK---PPTTYLPPVTVVRTTRPPPPPTRRTTVYVPP 885 Score = 30.3 bits (65), Expect = 6.0 Identities = 25/101 (24%), Positives = 30/101 (29%), Gaps = 5/101 (4%) Frame = +1 Query: 1009 PPXPLXXXXRSTTRSXXRXXHAATSXPRTPKYPPXSXXPXWXPXTXXPXT--PDTX---P 1173 PP P T + P P+ PP + P P T P T P T P Sbjct: 205 PPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLP 264 Query: 1174 PIRXXVXPXLXXXXHXPGQXSNPAXPXLPXXXLYPPPXKKP 1296 P+ + P P P Y PP KP Sbjct: 265 PVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKP 305 Score = 29.9 bits (64), Expect = 8.0 Identities = 21/75 (28%), Positives = 26/75 (34%), Gaps = 5/75 (6%) Frame = +1 Query: 1087 PRTPKYPPXSXXPXWXPXTXXPXT--PDTX---PPIRXXVXPXLXXXXHXPGQXSNPAXP 1251 P +P+ PP + P P T P T P T PP+ + P P P Sbjct: 274 PPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPP 333 Query: 1252 XLPXXXLYPPPXKKP 1296 Y PP KP Sbjct: 334 TTRPPATYLPPTNKP 348 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,553,559 Number of Sequences: 53049 Number of extensions: 266426 Number of successful extensions: 487 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 24,988,368 effective HSP length: 87 effective length of database: 20,373,105 effective search space used: 7049094330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -