BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K04 (876 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces p... 29 0.66 SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyc... 27 4.6 SPBC1709.15c |cft2||cleavage factor two Cft2/polyadenylation fac... 26 6.1 SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharo... 26 8.1 >SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 669 Score = 29.5 bits (63), Expect = 0.66 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -1 Query: 513 GALDNSYVVGV*EHSLVHVDSGVACCFV-ETFRIFGIIEQLEQ-RDGFFPHFFVKD 352 G + N Y+ + HS +AC V ET R FGI +EQ R P F D Sbjct: 612 GVISNKYLSMLSAHSSYWSSEDLACFLVVETGRNFGIANSIEQFRGKHMPRIFKGD 667 >SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 26.6 bits (56), Expect = 4.6 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = -1 Query: 477 EHSLVHVDSGVACCFVETFRIFGIIEQLEQRDGFFPHFFVKDREFQILGKESDLVHHH 304 ++ +++VD +A CFV+ R G LE+ + + + + + F +LG+ L+ HH Sbjct: 539 DNLILNVDGCIAVCFVDLLRNCGAF-TLEEANEYI-NLGILNGMF-VLGRSIGLIGHH 593 >SPBC1709.15c |cft2||cleavage factor two Cft2/polyadenylation factor CPSF-73 |Schizosaccharomyces pombe|chr 2|||Manual Length = 797 Score = 26.2 bits (55), Expect = 6.1 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +1 Query: 553 YPQYFVXMEVTNTMDYVXMMDGCLDEKICYNYGIIKXNEQFVMYANYSNSLDLPQ 717 +P F+ T T+DY M + + I ++GI NE + + N + D Q Sbjct: 255 FPILFLSPTSTKTIDYAKSMIEWMGDNIVRDFGI---NENLLEFRNINTITDFSQ 306 >SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 777 Score = 25.8 bits (54), Expect = 8.1 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 321 DLVHH-HEIFVGFHVCVAVLAGLDVEVLGDFVVLSFIVDLVNVVEKRQNLLLLF 163 DL HH + F GF VC+ ++ + + + D + L ++ +NVV N++ +F Sbjct: 243 DLEHHDYRSFRGF-VCLMQISNREKDWIVDTLELREELEALNVVFTNPNIIKVF 295 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,015,799 Number of Sequences: 5004 Number of extensions: 58114 Number of successful extensions: 161 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 438479610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -