BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K03 (846 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 3.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 8.2 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 3.5 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +2 Query: 188 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQVAY 304 TD RK ++ +++ K ++ ++V + N+D +AY Sbjct: 288 TDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAY 326 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 40 DFLPFFLLGVRLWTPLCNLXL 102 D +P FL + LW CN L Sbjct: 402 DAIPAFLSSLFLWLGYCNSLL 422 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,910 Number of Sequences: 438 Number of extensions: 3970 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -