BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K02 (875 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily a... 33 0.35 AC006610-7|AAK85451.1| 392|Caenorhabditis elegans Hypothetical ... 31 1.4 >AF067617-5|AAC17559.1| 2957|Caenorhabditis elegans Temporarily assigned gene nameprotein 192 protein. Length = 2957 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 6/63 (9%) Frame = +1 Query: 268 PRLKVPSRTSTQNTPPSKLRVPTSTLPLXGQPIDLAY-----VADENGYQ-PQGKPSAHP 429 P PS++ Q+ PPS+ ++P ++ P AY +GYQ P P A P Sbjct: 574 PASMEPSQSVDQSAPPSQAQIPATSTPSTSSQQQNAYPEFPDFPSSSGYQEPTVAPEAIP 633 Query: 430 SPN 438 SP+ Sbjct: 634 SPS 636 >AC006610-7|AAK85451.1| 392|Caenorhabditis elegans Hypothetical protein C30F12.5 protein. Length = 392 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +2 Query: 395 VTNPRXSHLPTPHPIPEAIARALAYXRGPPPQPLR-SWKEKSSPTC*DKSRQQHTXT 562 + +P S LP P I RA G PP PL S+ + P D R+Q T T Sbjct: 323 IGHPLYSPLPPIDPTYGTIPRARLAPNGAPPPPLSPSYSSGNDPHFLDPRRKQETQT 379 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,725,095 Number of Sequences: 27780 Number of extensions: 166658 Number of successful extensions: 614 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2202903780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -