BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K02 (875 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 36 5e-04 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 8.5 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 35.9 bits (79), Expect = 5e-04 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = +1 Query: 355 GQPIDLAYVADENGYQPQGK--PSAHPSP 435 GQ + + YVADENG+Q QG P+A P P Sbjct: 82 GQQVSITYVADENGFQVQGSHIPTAPPIP 110 Score = 29.5 bits (63), Expect = 0.043 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 240 NYETGNGIYAQAEGAVKNVNSEYPAIEVKGAYKY 341 N+ET NGI Q G K V++E P + +G+ Y Sbjct: 45 NFETSNGISHQESGQPKQVDNETPVVS-QGSDSY 77 Score = 28.3 bits (60), Expect = 0.098 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 413 SHLPTPHPIPEAIARALAYXRGPPPQ 490 SH+PT PIP I RAL + P + Sbjct: 101 SHIPTAPPIPPEIQRALEWNAAHPEE 126 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 8.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 280 VPSRTSTQNTPPSKLRVPTSTLP 348 +P S TP S + P TLP Sbjct: 654 LPRPISCHTTPDSFIEAPNKTLP 676 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,516 Number of Sequences: 438 Number of extensions: 2252 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -