BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_K01 (861 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73090.1 68414.m08451 expressed protein 29 4.0 At1g07650.1 68414.m00821 leucine-rich repeat transmembrane prote... 28 7.0 >At1g73090.1 68414.m08451 expressed protein Length = 306 Score = 29.1 bits (62), Expect = 4.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 255 LGPGXC*EKLWHDGRQLQRI 314 +GPG C + W +GR+LQ++ Sbjct: 272 IGPGVCVGQAWQEGRELQQV 291 >At1g07650.1 68414.m00821 leucine-rich repeat transmembrane protein kinase, putative similar to GB:AAC50043 from [Arabidopsis thaliana] (Plant Mol. Biol. 37 (4), 587-596 (1998)) Length = 1014 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 200 WLSVRXKQLRN*GKKLNPPWPRXLLRKTLAR 292 W S+R + L G +L+ P+P+ L R T+ R Sbjct: 134 WASMRLEDLSFMGNRLSGPFPKVLTRLTMLR 164 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,333,256 Number of Sequences: 28952 Number of extensions: 150387 Number of successful extensions: 259 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 259 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -