BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J23 (886 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19119| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_27954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_19119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1151 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +1 Query: 163 SSTIVFGDNAERVYSLDDKVKCCSRWLSIIIFNFCNNAYKI-VKREKMAPKDLQQDTTKQ 339 SS + F ++ + YS K+ CC WL + FC Y+ + ++ P L++ + Sbjct: 947 SSEVDFWESMFKRYSTWTKLVCCIAWLRRSVVAFCYRKYRSHEEHTRLEPLKLEELDDAE 1006 Query: 340 RHLV 351 R L+ Sbjct: 1007 RLLI 1010 >SB_27954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 278 TRLSKEKKWRLKIYNKTRPSNGISFEGKWRRVRRQVAN 391 +RLS+ + +I N P+NG+S G ++R +AN Sbjct: 201 SRLSELDETVSRIGNSLEPANGLSLNGSREKLRDPIAN 238 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,298,411 Number of Sequences: 59808 Number of extensions: 254796 Number of successful extensions: 682 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -