BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J19 (1352 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 40 0.005 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 38 0.024 02_05_0686 - 30900748-30902167,30903442-30904742 37 0.032 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 35 0.13 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 35 0.13 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 33 0.39 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 33 0.39 07_01_0080 + 587674-588510 33 0.39 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 33 0.52 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.68 03_01_0515 - 3864796-3865425 33 0.68 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 32 0.91 07_03_1136 + 24218601-24218734,24218769-24219906 32 0.91 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 32 0.91 12_01_0135 + 1042889-1044255,1045368-1045809 32 1.2 01_05_0490 + 22672241-22674679 32 1.2 01_01_0046 - 331758-332627 32 1.2 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 31 1.6 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 31 1.6 07_03_1636 + 28290642-28291574 31 1.6 06_01_0486 - 3455030-3455770 31 1.6 12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325,680... 31 2.1 10_08_0161 + 15312986-15313160,15313250-15313557,15313676-153137... 31 2.1 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 2.1 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 31 2.8 11_01_0359 - 2731522-2732346 31 2.8 11_01_0133 + 1121392-1122731,1123417-1123858 31 2.8 06_03_0696 + 23617687-23617851,23618838-23619536 31 2.8 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 30 3.7 02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182... 30 3.7 09_02_0603 - 11150739-11150746,11150791-11151340 30 4.8 08_02_1019 - 23657175-23658047 30 4.8 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 30 4.8 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 30 4.8 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 30 4.8 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 30 4.8 01_06_0046 + 25943183-25943590 30 4.8 01_03_0005 + 11568545-11569119,11569179-11569191 30 4.8 12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203,219... 29 6.4 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 29 6.4 09_06_0125 - 21011757-21012428 29 6.4 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 29 6.4 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 6.4 01_07_0122 - 41196081-41196205,41197561-41198245,41198961-411993... 29 6.4 12_02_0299 - 17051570-17052474,17053542-17053755 29 8.4 08_01_0059 - 394001-394708 29 8.4 07_01_0516 - 3850252-3852870 29 8.4 06_01_0561 - 3983308-3983564,3983652-3983775 29 8.4 05_03_0458 + 14280953-14281866,14281964-14282912 29 8.4 04_04_0057 + 22410167-22411330 29 8.4 01_07_0082 - 40965947-40967023 29 8.4 01_06_0146 + 26969011-26969995,26970878-26970930 29 8.4 01_01_0796 + 6190931-6192745 29 8.4 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP G PPPPP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPP 110 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -3 Query: 648 FFXXAXPPPPXXFXXXXPPP--XPPXGCXFFXPPPPP 544 ++ PPPP PPP PP PPPPP Sbjct: 89 YYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPP 125 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 37.5 bits (83), Expect = 0.024 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -1 Query: 629 PPPPXFFXXXPPPXXPXGGVXFFXPPPP 546 PPPP PPP P GG+ PPPP Sbjct: 1099 PPPPSIGAGAPPPPPPPGGITGVPPPPP 1126 Score = 35.9 bits (79), Expect = 0.074 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPP 547 PPPP PPP PP G PPPP Sbjct: 1099 PPPPSIGAGAPPPPPPPGGITGVPPPPP 1126 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP F PPP G PPPPP Sbjct: 1163 PPPPAGFRGGTPPPNAHGGVA--PPPPPP 1189 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 629 PPPPXFFXXXPPPXXPXGGVXFFXPPPP 546 PPPP F PP GGV PPPP Sbjct: 1163 PPPPAGFRGGTPPPNAHGGVA--PPPPP 1188 Score = 29.1 bits (62), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 627 PPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPP PPP PP G PP P Sbjct: 1174 PPPNAHGGVAPPPPPPRGHGGVGGPPTP 1201 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 37.1 bits (82), Expect = 0.032 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP G PPPPP Sbjct: 354 PPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 36.7 bits (81), Expect = 0.042 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP G PPPPP Sbjct: 353 PPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 33.1 bits (72), Expect = 0.52 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 316 PPPPKPAAAAPPPPPPPKAA---PPPPPP 341 Score = 33.1 bits (72), Expect = 0.52 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 627 PPPXXFXXXXPPPXPPXGCXFFXPPPPPXXXXKK 526 PPP PPP PP G PPPPP KK Sbjct: 344 PPPPPPAKGPPPPPPPKGP---SPPPPPPPGGKK 374 Score = 32.3 bits (70), Expect = 0.91 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPPP PPP PP G PPPPP Sbjct: 324 AAPPPPPP-PKAAPPPPPPKG----PPPPPP 349 Score = 31.5 bits (68), Expect = 1.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PP PP PPPPP Sbjct: 329 PPPPKAAPPPPPPKGPPPPPPAKGPPPPP 357 Score = 29.9 bits (64), Expect = 4.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 629 PPPPXFFXXXPPPXXPXGGVXFFXPPPP 546 PPPP PPP P GG PPPP Sbjct: 354 PPPPPPKGPSPPPPPPPGGKKG-GPPPP 380 Score = 29.1 bits (62), Expect = 8.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = -3 Query: 630 PPPPXXFXXXXPPPX--PPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 35.1 bits (77), Expect = 0.13 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPPP PPP PP G PPPPP Sbjct: 612 ALPPPPPR-PPGAPPPPPPPGKPGGPPPPPP 641 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 35.1 bits (77), Expect = 0.13 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 112 PPPPRKKPQFQPPPQPPRAWDPSPPPPPP 140 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 P PP + PPP P PPP P Sbjct: 125 PQPPRAWDPSPPPPPPAPAAPVLVPPPAP 153 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 33.5 bits (73), Expect = 0.39 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP G PPPPP Sbjct: 920 PPPPRP--PGAPPPPPPPGKPGGPPPPPP 946 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPP PPP PP PPPPP Sbjct: 917 ALSPPPPRPPGAPPPPPPPGKPGGPPPPPPP 947 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 33.5 bits (73), Expect = 0.39 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPP PPP P G F PPPPP Sbjct: 641 PPPSLPNRLVPPPPAPGIGNKFPAPPPPP 669 Score = 32.7 bits (71), Expect = 0.68 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCX-FFXPPPPP 544 A PPPP PPP PP G F PPPPP Sbjct: 542 AAPPPPP------PPPPPPSGNKPAFSPPPPP 567 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 629 PPPPXFFXXXPPPXXPXGGVXFFXPPPP 546 PPPP PPP P G F PPPP Sbjct: 544 PPPPP-----PPPPPPSGNKPAFSPPPP 566 Score = 30.7 bits (66), Expect = 2.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 645 FXXAXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 + + PPPP PPP P C PPPPP Sbjct: 580 YASSQPPPP-------PPPPPLPNCLVPSPPPPP 606 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = -3 Query: 630 PPP--PXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPP P PPP PP PPPPP Sbjct: 608 PPPILPNRSVPPPPPPPPPLPNHSVLPPPPP 638 Score = 29.5 bits (63), Expect = 6.4 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPPXXXXKKXFFFXXKXIFFXPPPRGGXXWGXXX 451 PPPP PPP P PPPPP PPP Sbjct: 563 PPPPPP--PPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPP 620 Query: 450 KXPXXXXXXXXXXKXPPPXPP 388 P PPP PP Sbjct: 621 PPPPPPLPNHSVLPPPPPPPP 641 Score = 29.1 bits (62), Expect = 8.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PP P G P PPP Sbjct: 639 PPPPPSLPNRLVPPPPAPGIGNKFPAPPP 667 >07_01_0080 + 587674-588510 Length = 278 Score = 33.5 bits (73), Expect = 0.39 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 645 FXXAXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 F PPPP PPP PP PPPPP Sbjct: 88 FRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 33.1 bits (72), Expect = 0.52 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPPP PP PP PPPPP Sbjct: 279 APPPPPPNAPMGMPPRIPPPPVGGTQPPPPP 309 Score = 29.9 bits (64), Expect = 4.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 Query: 628 PPPPXFXXXXPPPXXPXGVXFFFXPPP 548 PPPP PPP P G+ PPP Sbjct: 273 PPPPPQAPPPPPPNAPMGMPPRIPPPP 299 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 32.7 bits (71), Expect = 0.68 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPPP PPP P PPPPP Sbjct: 348 APPPPPPPPPPPPPPPPPKLNTAPKPPPPPP 378 >03_01_0515 - 3864796-3865425 Length = 209 Score = 32.7 bits (71), Expect = 0.68 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPP Sbjct: 91 PPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Score = 32.3 bits (70), Expect = 0.91 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PP PP PPPPP Sbjct: 92 PPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 61 PPPPAAGPLMPPPPPPP--SVTSSPPPPP 87 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPP Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPP 102 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = -3 Query: 630 PPPPXXFXXXXPPP--XPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPPPPP 103 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 32.3 bits (70), Expect = 0.91 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPPP P PP F PPPP Sbjct: 52 APPPPPQVIRVFAAAPPPPPAAFFAAVPPPP 82 Score = 31.9 bits (69), Expect = 1.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 645 FXXAXPPPPXXFXXXXPPPXPP 580 F A PPPP F PPP PP Sbjct: 63 FAAAPPPPPAAFFAAVPPPPPP 84 Score = 29.5 bits (63), Expect = 6.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -3 Query: 636 AXPPPPXXF--XXXXPPPXPPXGCXFFXPPPPP 544 A PPPP PP PP PPPPP Sbjct: 51 AAPPPPPQVIRVFAAAPPPPPAAFFAAVPPPPP 83 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 32.3 bits (70), Expect = 0.91 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGG 630 GGGG + P G GGG + GGGG Sbjct: 125 GGGGGARPPAPGGGGGGGAPRRVLGGGG 152 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 546 GGGGXKKXNTPXGXXGGGXXXKKXGGGG 629 GGGG + P G GGG + GGGG Sbjct: 125 GGGGGARPPAPGGGGGGGAPRRVLGGGG 152 Score = 31.5 bits (68), Expect = 1.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 546 GGGGXKKXNTPXGXXGGGXXXKKXGGGG 629 GGGG P G GGG + GGGG Sbjct: 176 GGGGGGPGRAPGGGGGGGGPGRAPGGGG 203 Score = 30.7 bits (66), Expect = 2.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGG 630 GGGG PP GGG GGGG Sbjct: 112 GGGGGPPSLPPGAGGGGGARPPAPGGGG 139 Score = 30.7 bits (66), Expect = 2.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGG 630 GG G PP G GGG + GGGG Sbjct: 163 GGRGGALGRPPGGGGGGGGPGRAPGGGG 190 Score = 30.7 bits (66), Expect = 2.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGG 630 GGGG P G GGG + GGGG Sbjct: 176 GGGGGGPGRAPGGGGGGGGPGRAPGGGG 203 Score = 30.3 bits (65), Expect = 3.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGG 630 GGGG PP G GG GGGG Sbjct: 151 GGGGGALARPPGGGRGGALGRPPGGGGG 178 Score = 29.9 bits (64), Expect = 4.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 546 GGGGXKKXNTPXGXXGGGXXXKKXGGGG 629 GGGG + G GGG K GGGG Sbjct: 254 GGGGALECEIGGGGGGGGTDRNKGGGGG 281 Score = 29.5 bits (63), Expect = 6.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGG 630 GGGG P G GGG GGGG Sbjct: 177 GGGGGPGRAPGGGGGGGGPGRAPGGGGG 204 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 32.3 bits (70), Expect = 0.91 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPP 547 PPPP PPP PP PPPP Sbjct: 120 PPPPPPHPPEDPPPHPPHPPDHPPPPPP 147 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 636 AXPPPPXXFXXXXPP----PXPPXGCXFFXPPPPPXXXXKK 526 A PPPP PP P PP PPPPP K+ Sbjct: 135 APPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPAQPDKR 175 >01_05_0490 + 22672241-22674679 Length = 812 Score = 31.9 bits (69), Expect = 1.2 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPPXXXXKKXFFFXXKXIFF---XPPP 481 PPPP PP PP PPPPP + F+ +++ PPP Sbjct: 643 PPPPPTTRRSRKPPQPPSRPA---PPPPPPPQQQPPFYPRRAVVYYTYPLPPP 692 >01_01_0046 - 331758-332627 Length = 289 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 657 FFFFFXXAXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 ++F + + PPPP PPP PP + PP PP Sbjct: 13 YWFPYWTSPPPPP-------PPPPPPPSSSRYRPPSPP 43 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 31.5 bits (68), Expect = 1.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPPP PPP PP PPPPP Sbjct: 71 AAPPPPQTPPSPPPPPPPP------PPPPPP 95 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 31.5 bits (68), Expect = 1.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPP 547 A PPPP PPP PP PP P Sbjct: 1167 ATPPPPPPLSPSLPPPPPPPPLPSGPPPQP 1196 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PP P PPP PP PPPPP Sbjct: 1158 PPLPPSPPPATPPPPPPLSPSLPPPPPPP 1186 >07_03_1636 + 28290642-28291574 Length = 310 Score = 31.5 bits (68), Expect = 1.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP + PP PP PPPPP Sbjct: 170 PPPPDAYLRKPSPPSPPPA--KLSPPPPP 196 >06_01_0486 - 3455030-3455770 Length = 246 Score = 31.5 bits (68), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 P PP PPP PP + PP PP Sbjct: 94 PSPPPYVPPYIPPPTPPYVPPYIPPPTPP 122 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PP P PPP PP + PP PP Sbjct: 126 PPTPPSPPPYVPPPTPPSPPPYVPPPSPP 154 >12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325, 6800407-6800454,6801740-6801836,6801922-6802001, 6802099-6802170,6802335-6802429,6802853-6802934, 6805476-6805853 Length = 478 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPP 547 PPPP P PP FF PPPP Sbjct: 45 PPPPPVIRVFAAAPPPPRAA-FFAPPPP 71 >10_08_0161 + 15312986-15313160,15313250-15313557,15313676-15313754, 15313856-15314373 Length = 359 Score = 31.1 bits (67), Expect = 2.1 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 546 GGGGXKKXNTPXGXXGGGXXXKKXGGGGXXXXKKKKKK 659 GGG KK G GG +K GGG ++KK K Sbjct: 120 GGGDDKKAEKEKGGGGGDKKAEKEKGGGDKPKEEKKAK 157 Score = 29.5 bits (63), Expect = 6.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGGXRXXKKKKKK 660 GGG KK G GG + GGG + ++KK K Sbjct: 120 GGGDDKKAEKEKGGGGGDKKAEKEKGGGDKPKEEKKAK 157 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 412 PPPPPTHTHGPPPPPPP-------PPPPP 433 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPP 580 PPPP F PPP PP Sbjct: 357 PPPPPPFAPTLPPPPPP 373 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 627 PPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPP P P P G PPPPP Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPPP 48 >11_01_0359 - 2731522-2732346 Length = 274 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP + PP PP + P PPP Sbjct: 54 PPPPHAYHHHHYPPPPPPHHHPYPPHPPP 82 Score = 29.1 bits (62), Expect = 8.4 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -3 Query: 645 FXXAXP-PPPXXFXXXXPPPXPPXGCXF--FXPPPPP 544 F A P P P PPP PP + PPPPP Sbjct: 35 FAVAYPYPAPPPHSHSHPPPPPPHAYHHHHYPPPPPP 71 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -3 Query: 630 PPPPXXFXXXXPP----PXPPXGCXFFXPPPPPXXXXKK 526 PPPP PP P PP PPPPP K+ Sbjct: 136 PPPPPSHPALLPPDATAPPPPPTSVAALPPPPPPQPDKR 174 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 30.7 bits (66), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 77 PPPPPP---PPPPPSPPATHDVGQPPPPP 102 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPP 547 PPPP PPP P F PPP Sbjct: 51 PPPPPPMVAAPPPPPPQYAKHFAAGPPP 78 >02_04_0289 + 21615745-21616155,21617417-21617870,21618162-21618217, 21618307-21618437,21618565-21618727 Length = 404 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = -3 Query: 627 PPPXXFXXXXPPPXPPXGCXFFXPP----PPP 544 PPP PPP PP F PP PPP Sbjct: 54 PPPHGMVAAAPPPPPPQFVKHFAPPASVTPPP 85 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 29.9 bits (64), Expect = 4.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = -3 Query: 645 FXXAXPPPPXXFXXXXP----PPXPPXGCXFFXPPP 550 F PPPP P PP PP G FF PPP Sbjct: 41 FGFPPPPPPGSTFVPLPQSGVPPPPPLG-SFFVPPP 75 >08_02_1019 - 23657175-23658047 Length = 290 Score = 29.9 bits (64), Expect = 4.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGGXR 636 GGGG P G GGG GGGG R Sbjct: 33 GGGGGGVPKPGGGVGGGGGGGGGGGGGGAR 62 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.9 bits (64), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLP 453 Score = 29.9 bits (64), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PP PP Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPP 454 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 29.9 bits (64), Expect = 4.8 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = -2 Query: 625 PPPXFXXXXPP------PXXPXGVXFFFXPPPPXXXXKKXFFFXXKKXFFXPPP 482 PPP PP P P G F PPPP +F PPP Sbjct: 237 PPPSLPGVGPPRGGGAIPGLPAGFPFLLRPPPPLPVPGVICRPPPSPPYFAPPP 290 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 29.9 bits (64), Expect = 4.8 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFX--PPPPP 544 PPPP PPP PP + PPPPP Sbjct: 30 PPPP--MGPPPPPPMPPVPVMYLRGVPPPPP 58 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.9 bits (64), Expect = 4.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 353 PPPPPP--PPPPPPPPPPPPPRPPPPPPP 379 Score = 29.9 bits (64), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PP PP Sbjct: 362 PPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >01_06_0046 + 25943183-25943590 Length = 135 Score = 29.9 bits (64), Expect = 4.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 629 PPPPXFFXXXPPPXXPXGGVXFFXPPPP 546 PPPP ++ PPP G + PPPP Sbjct: 56 PPPPPYYYYSPPPPAYYPG--SYCPPPP 81 Score = 29.5 bits (63), Expect = 6.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPP 547 A PPPP + PPP G + PPPP Sbjct: 54 ALPPPPPYYYYSPPPPAYYPGS--YCPPPP 81 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 29.9 bits (64), Expect = 4.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGG 630 GGGG P G GGG + GGGG Sbjct: 107 GGGGIYYPPPTGGGGGGGGGWQQGGGGG 134 >12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203, 2195479-2195505,2195794-2196024,2196523-2196692, 2197278-2197421,2198036-2198083,2198503-2198566 Length = 749 Score = 29.5 bits (63), Expect = 6.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 546 GGGGXKKXNTPXGXXGGGXXXKKXGGGG 629 GGGG K GGG K GGGG Sbjct: 278 GGGGKKDAGGKQNQGGGGGNGKNGGGGG 305 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 29.5 bits (63), Expect = 6.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PP P + PPPPP Sbjct: 380 PPPPMSPSCLLPPIIPAPTFTYSSPPPPP 408 >09_06_0125 - 21011757-21012428 Length = 223 Score = 29.5 bits (63), Expect = 6.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 594 PPXPPXGCXFFXPPPPP 544 PP PP F PPPPP Sbjct: 171 PPPPPPRAPFLAPPPPP 187 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.5 bits (63), Expect = 6.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = -3 Query: 630 PPPPXXF---XXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP PP PPPPP Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPPP 69 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.5 bits (63), Expect = 6.4 Identities = 22/83 (26%), Positives = 22/83 (26%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPPXXXXKKXFFFXXKXIFFXPPPRGGXXWGX 457 A PPPP PPP PP PPP PPP Sbjct: 274 AAPPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGT--GAPPPPPAHPAAP 331 Query: 456 XXKXPXXXXXXXXXXKXPPPXPP 388 P PPP PP Sbjct: 332 APPPPAPSPSAAGAGSGPPPPPP 354 >01_07_0122 - 41196081-41196205,41197561-41198245,41198961-41199329, 41199405-41199514,41200539-41200833 Length = 527 Score = 29.5 bits (63), Expect = 6.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 547 GGGGXKKXTPPXGXXGGGXXXKXXGGGGXR 636 G G ++ PP G GGG GGGG R Sbjct: 7 GEGQHQQQRPPDGAGGGGGGRGGRGGGGGR 36 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.1 bits (62), Expect = 8.4 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = -3 Query: 630 PPPPXXFXXXXP--PPXP--PXGCXFFXPPPPP 544 PPPP F P PP P P F+ PPPP Sbjct: 291 PPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPP 323 >08_01_0059 - 394001-394708 Length = 235 Score = 29.1 bits (62), Expect = 8.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 636 AXPPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 A PPPP PPP PP PPPPP Sbjct: 15 ATPPPPPR--RAPPPPSPP-----IRPPPPP 38 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.1 bits (62), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPP 547 P PP PPP PP PPPP Sbjct: 17 PQPPPTSRPLPPPPPPPPPAHGPSPPPP 44 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 29.1 bits (62), Expect = 8.4 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 599 PPPXXPXGGVXFFXPPPPXXXXKKKXFFFXKKXFFFXPPP 480 PPP GG+ PPPP ++ FF + PPP Sbjct: 88 PPPTSNDGGIESISPPPP---PEQDGQFFSSTGYPTRPPP 124 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 29.1 bits (62), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = -3 Query: 627 PPPXXFXXXXPPPXPPX--GCXFFXPPPPP 544 PPP PPP PP C PPPP Sbjct: 65 PPPLPPLQPTPPPLPPTTLSCSSHPTPPPP 94 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.1 bits (62), Expect = 8.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP P P C PPPPP Sbjct: 185 PPPPPAAAAASPSPERSPRCQPSPPPPPP 213 >01_07_0082 - 40965947-40967023 Length = 358 Score = 29.1 bits (62), Expect = 8.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPP + PP P G + PPPPP Sbjct: 256 PPPQYGYGYPAQPPPPQAGYGY--PPPPP 282 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 29.1 bits (62), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 630 PPPPXXFXXXXPPPXPPXGCXFFXPPPPP 544 PPPP PPP P PPPPP Sbjct: 23 PPPPTPHPATDPPPISPQNP---TPPPPP 48 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.1 bits (62), Expect = 8.4 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = -3 Query: 627 PPPXXFXXXXPPPXPPXGCXFFXP--PPPP 544 PPP PPP P G + P PPPP Sbjct: 229 PPPFVADQPPPPPPPAAGGSLWIPELPPPP 258 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,009,054 Number of Sequences: 37544 Number of extensions: 475178 Number of successful extensions: 4810 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3195 length of database: 14,793,348 effective HSP length: 84 effective length of database: 11,639,652 effective search space used: 4260112632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -