BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J14 (849 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0530 + 3971990-3972331,3972415-3972489,3972608-3972661,397... 29 4.7 >03_01_0530 + 3971990-3972331,3972415-3972489,3972608-3972661, 3972747-3972825,3972927-3973054,3973178-3973261, 3973344-3973427,3973518-3973669,3973810-3973960, 3974675-3974746,3975708-3975749 Length = 420 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +3 Query: 345 TLTANLKPL-RTSLTRLDTMLRGESIPQVASXTS*TSKFPGIDLSNEALIQDCVAKHPP 518 TL N +PL R+ LTR S +S +S F G+D +E L++ A P Sbjct: 19 TLLLNARPLLRSRLTRRPFRAVSSSTASPSSSSSGARDFGGVDFGDERLLRCAAAGRAP 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,343,348 Number of Sequences: 37544 Number of extensions: 293923 Number of successful extensions: 706 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -