BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J13 (1218 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hed... 30 2.9 Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical pr... 29 6.7 AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ... 29 6.7 >U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hedgehog-like family)protein 7 protein. Length = 401 Score = 30.3 bits (65), Expect = 2.9 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +1 Query: 481 PPPPRXTXPXPYVKXAL---XXPXPPXPXXXXQXXTXGPSPXTXP 606 PPPP P PYV+ + PP P Q P+P P Sbjct: 27 PPPPPPPKPAPYVEQSAQPQQTAPPPPPAPYPQQAVPAPAPPPAP 71 >Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical protein F33E2.6 protein. Length = 846 Score = 29.1 bits (62), Expect = 6.7 Identities = 17/63 (26%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +2 Query: 425 PRXSPTEXXXPXXXPTXXGPPPXEXXRPDXT*SXPXXXXPP--PGPXXPXXXXXXGRLRX 598 P P + P P PPP E + + + P PP P P RL Sbjct: 383 PTTEPPKIEPPRTEPPKTEPPPTEPPKTEPPKTTPPKTEPPTTEPPNIPYCWQQQSRLFA 442 Query: 599 PAP 607 P+P Sbjct: 443 PSP 445 >AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical protein F59E12.9 protein. Length = 1621 Score = 29.1 bits (62), Expect = 6.7 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 481 PPPPRXTXPXPYVKXALXXPXPPXPXXXXQXXTXGPSPXTXP 606 PPPP P P P PP P + T P P P Sbjct: 1338 PPPPPPPPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPP 1379 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,788,566 Number of Sequences: 27780 Number of extensions: 167069 Number of successful extensions: 504 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,740,198 effective HSP length: 83 effective length of database: 10,434,458 effective search space used: 3359895476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -