BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J12 (873 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.78 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.78 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 22 5.5 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 21 9.6 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 21 9.6 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 9.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.0 bits (52), Expect = 0.78 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 731 GVVIACQTSAYSMFVVE*AIE*NCSLFLNPLSAI 832 G+ IA T+ S FVV +E N +L+L P+S I Sbjct: 218 GLDIASITAQASSFVVWPLVENNPTLYLIPVSVI 251 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.0 bits (52), Expect = 0.78 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 731 GVVIACQTSAYSMFVVE*AIE*NCSLFLNPLSAI 832 G+ IA T+ S FVV +E N +L+L P+S I Sbjct: 218 GLDIASITAQASSFVVWPLVENNPTLYLIPVSVI 251 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = +1 Query: 181 GYSFVIFDIAFRINKILSGTDNFLFIYYTIRIHNSFKKI 297 G+ IFD+ +N+ + + YT+ I N + Sbjct: 156 GWHTYIFDVPNFVNEYVQAIEVLYICSYTVLIRNKISNL 194 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 338 THKTQCRKNEPVYNLP 385 TH Q KN+ VY++P Sbjct: 299 THPYQMIKNQQVYDVP 314 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 338 THKTQCRKNEPVYNLP 385 TH Q KN+ VY++P Sbjct: 299 THPYQMIKNQQVYDVP 314 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 338 THKTQCRKNEPVYNLP 385 TH Q KN+ VY++P Sbjct: 299 THPYQIIKNQQVYDVP 314 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,333 Number of Sequences: 336 Number of extensions: 2814 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24099889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -