BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J11 (898 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 26 0.46 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 1.4 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 4.3 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 5.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.7 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 7.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.9 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.8 bits (54), Expect = 0.46 Identities = 24/103 (23%), Positives = 47/103 (45%), Gaps = 8/103 (7%) Frame = +3 Query: 186 EQLYMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQL------- 344 + L++ V+ Y + K + G + + ++ E+G R + FA + Sbjct: 583 KDLFLEAVLLRYPD-LNKIFYVQTDSSGYGLGAELYQIQEDGSRGVIAFASRSLRGPELN 641 Query: 345 WTKDGKEIVKSYFPI-QFRVIFTEQTVKLINKRDHHALKLIDQ 470 +T KE++ F + +FR+ Q K+I + DH ALK + + Sbjct: 642 YTTTEKELLGVIFALHKFRIYI--QVTKIIIRTDHQALKFLSR 682 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 523 KSPGKFTPVLENNRVYFKIMSTEDKQYLKLDNTK 624 K P + ++E VY+K +ST+DK +K + K Sbjct: 1222 KPPVEPNGIVEYYTVYYKPVSTDDKTEVKPTSQK 1255 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 4.3 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -2 Query: 519 CWFCLWSHRMQFCCGFV 469 C F +++ + FCC F+ Sbjct: 171 CAFIIFTMHLLFCCAFI 187 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 22.2 bits (45), Expect = 5.7 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -1 Query: 187 SASTSSVLGASVALEASAHTARTKANKVXLHSWRSGXSLKAXQQTTQSLKD 35 + TS V + +LEAS + + H W++ S +A + Q L + Sbjct: 88 NGDTSQVDDQNESLEASVNENSKNGDDDEGHEWQADVSEEAVRARMQDLTE 138 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.7 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = +3 Query: 321 TMDFAYQLWTKDG---KEIVKS--YFPIQFRVIFTEQT 419 ++D+A + WTK G +IV +F F + FT +T Sbjct: 395 SVDYAVKFWTKKGFPKSKIVLGVPFFGRSFTLQFTNET 432 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 7.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 526 TFLLVLSLESPNAILLWFCWSINLRA*WSLLFMSLTV 416 T+L+ E + +LW C S N +L +S TV Sbjct: 242 TYLIWTIYEMYHLAILWSCTSTNCPRFLIMLALSYTV 278 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 757 YDTXMKIWPPTKTVXPWG 810 + T M+I PP K P+G Sbjct: 652 HQTHMRIRPPKKIPTPYG 669 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 757 YDTXMKIWPPTKTVXPWG 810 + T M+I PP K P+G Sbjct: 652 HQTHMRIRPPKKIPTPYG 669 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 757 YDTXMKIWPPTKTVXPWG 810 + T M+I PP K P+G Sbjct: 652 HQTHMRIRPPKKIPTPYG 669 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 757 YDTXMKIWPPTKTVXPWG 810 + T M+I PP K P+G Sbjct: 652 HQTHMRIRPPKKIPTPYG 669 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,648 Number of Sequences: 336 Number of extensions: 4472 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -