BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J11 (898 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05170.1 68415.m00544 vacuolar protein sorting 11 family prot... 31 1.0 At1g62250.2 68414.m07023 expressed protein 30 1.8 At1g62250.1 68414.m07022 expressed protein 30 1.8 At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (AT... 29 5.5 At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A... 29 5.5 At1g64150.1 68414.m07267 expressed protein contains Pfam profile... 29 5.5 At5g43530.1 68418.m05322 SNF2 domain-containing protein / helica... 28 7.3 At3g04160.1 68416.m00440 expressed protein ; expression supporte... 28 9.7 At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain... 28 9.7 >At2g05170.1 68415.m00544 vacuolar protein sorting 11 family protein / VPS11 family protein similar to Vacuolar protein sorting 11 (hVPS11) (PP3476) (Swiss-Prot:Q9H270) [Homo sapiens]; similar to Vacuolar biogenesis protein END1 (PEP5 protein) (Vacuolar protein sorting 11) (Swiss-Prot:P12868) [Saccharomyces cerevisiae] Length = 932 Score = 31.1 bits (67), Expect = 1.0 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 4/85 (4%) Frame = +3 Query: 210 IGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQLWTKDG--KEIVKSYF 383 +G Y+ A+ S + G I++ K LIE+ + T+D +L T+ G + S Sbjct: 498 LGNYDEALQYVSSLEPSQAGVTIEQYGKILIEHKPKETIDILMRLCTEQGIPNGVFLSML 557 Query: 384 --PIQFRVIFTEQTVKLINKRDHHA 452 P+ F +F + L++ + +A Sbjct: 558 PSPVDFITVFVQHPHSLMHFLERYA 582 >At1g62250.2 68414.m07023 expressed protein Length = 223 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 106 LCLPSSSPCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 234 LC P + +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g62250.1 68414.m07022 expressed protein Length = 267 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 106 LCLPSSSPCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 234 LC P + +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (ATHIM) identical to SP|P34881 DNA (cytosine-5)-methyltransferase AthI (EC 2.1.1.37) {Arabidopsis thaliana} Length = 1534 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 354 PLSITGRRSPWCSSCRFRSDASR 286 PLS GR S +C+SC+ R D + Sbjct: 869 PLSDIGRSSGFCTSCKIREDEEK 891 >At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A19) Identical to Cytochrome P450 (SP:Q9T0K0) [Arabidopsis thaliana]; similar to cytochrome P450LXXIA1, Persea americana, M32885 Length = 490 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 452 GVMVPFVYELDSLLGEDHSKLDGEVRFDDFL 360 G +P + +D + G+DH + + RFD+FL Sbjct: 221 GEYIPSLSWIDKIRGQDHKMEEVDKRFDEFL 251 >At1g64150.1 68414.m07267 expressed protein contains Pfam profile PF01169: Uncharacterized protein family UPF0016 Length = 370 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 672 GVSGAITVDDTVITRTFRVIELQVLFVLGGHDLEVNSV 559 G G +T+ V+ RTF ++ + F GG DL ++ + Sbjct: 197 GALGIMTIISVVLGRTFHYVDEVLPFRFGGTDLPIDDI 234 >At5g43530.1 68418.m05322 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to SP|P36607 DNA repair protein rad8 {Schizosaccharomyces pombe}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1277 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +3 Query: 411 EQTVKLINKRDHHALKLIDQQNHNKIAFGDSKDKTSK--KVSWEVYPRVGKQQSLL 572 ++ +K++ + K ++Q+N + + GDS ++K K+ E Y VG + +L Sbjct: 255 DEVIKVLEDQPSEINKKLEQENDDLFSSGDSDGTSAKRRKMEMESYAPVGVESCIL 310 >At3g04160.1 68416.m00440 expressed protein ; expression supported by MPSS Length = 712 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 284 SREASDRKRQEEHHGLRLPVMDKGWKGNRQILLPHPV 394 SR ++E G +P DK WKG + + +P+ Sbjct: 563 SRSPIGNDQKESDFGYSIPSTDKQWKGENRADIEYPI 599 >At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 697 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 195 YMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQ 341 YM + +GEY AI +C+ L E K +KR N +DFA++ Sbjct: 100 YMQMGLGEYPNAINECNLAL-EASPRFSKALLKRARCYEALNKLDFAFR 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,852,010 Number of Sequences: 28952 Number of extensions: 395201 Number of successful extensions: 1291 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1291 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2110422216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -