BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J08 (907 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07777.1 68415.m00893 expressed protein 29 3.2 At1g73090.1 68414.m08451 expressed protein 28 7.4 >At2g07777.1 68415.m00893 expressed protein Length = 262 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -1 Query: 304 LSTIVPKFFLTVSGAKADSTFSLNSSIVFFALSASVFRLLXSLGAXRLTNACTLA 140 LS+ V FF G+++ S F+L ++ S +FR L R+T C LA Sbjct: 11 LSSSVAGFFGRFLGSESVSRFNLIIFLILLVFSICLFRSLKQYLGKRMTQWCYLA 65 >At1g73090.1 68414.m08451 expressed protein Length = 306 Score = 28.3 bits (60), Expect = 7.4 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 257 LGPGDC*EKLWHDGRQLQRI 316 +GPG C + W +GR+LQ++ Sbjct: 272 IGPGVCVGQAWQEGRELQQV 291 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,101,965 Number of Sequences: 28952 Number of extensions: 147559 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -