BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J06 (875 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.78 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 4.2 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 5.5 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.0 bits (52), Expect = 0.78 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +2 Query: 623 YKVHLLI*HYMFYSNG----CLRNSDFRFFFFCVYLYLIFSLGYLTKPVFITM 769 + VH L+ Y FY C+ + F F V+L + + Y P+F + Sbjct: 92 FTVHFLLCTYYFYYAFIILLCVYYFYYAFIIFTVHLLFLLCIYYFVVPLFFLL 144 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -1 Query: 608 ICLRFIIYYHNILKLHYIASLKYISAHVYLITLM 507 IC ++ YH + LKY +Y++T++ Sbjct: 21 ICDSYLKIYHKEKYRKFCRILKYFIIAIYVLTIL 54 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 683 SDFRFFFFCVYLYLIFSL 736 S + F C+YL+LI +L Sbjct: 284 SGYTVTFLCLYLFLIITL 301 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,086 Number of Sequences: 336 Number of extensions: 3325 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -