BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J06 (875 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5940| Best HMM Match : Antimicrobial_3 (HMM E-Value=2.4) 28 8.6 SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 28 8.6 >SB_5940| Best HMM Match : Antimicrobial_3 (HMM E-Value=2.4) Length = 409 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 247 VASHFLNFLEELPPGLGSSADRAESQHQREDEAQNTYKI 131 + S L+ +E+ PG+G DR + R+ EAQ ++ Sbjct: 12 IMSRILSTIEKTQPGVGVVHDRQRTHDPRDKEAQEEERV 50 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 243 RPTFSIFLKSFHLGSGAALTAPRASTN 163 RP+F + LKS G+GAA P TN Sbjct: 1831 RPSFKLVLKSLEEGNGAARVRPCRITN 1857 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,987,030 Number of Sequences: 59808 Number of extensions: 332805 Number of successful extensions: 749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -