BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J04 (876 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.1 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.1 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 9.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 9.6 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 9.6 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 597 LTSGNLNXARRRASMTCAFHLSL 529 LTS L RR +T AFH S+ Sbjct: 123 LTSTGLKWQTRRKILTPAFHFSI 145 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 597 LTSGNLNXARRRASMTCAFHLSL 529 LTS L RR +T AFH S+ Sbjct: 123 LTSTGLKWQTRRKILTPAFHFSI 145 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.4 bits (43), Expect = 9.6 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +1 Query: 241 LSTGACTWCPTNMKQLSSEALEAGRICCNKYLVKNCGKDQFHI 369 L G CT +K EAL CN+ + N K H+ Sbjct: 46 LDKGRCTPEGKKLKSTIPEALSTDCAKCNEKVKANVRKVLHHL 88 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 349 GKDQFHIRMRXHPFHVIRINKMLSCAG 429 G D I P H +R+N ++S +G Sbjct: 364 GHDLTLIATDGEPVHPVRVNTIISFSG 390 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 349 GKDQFHIRMRXHPFHVIRINKMLSCAG 429 G D I P H +R+N ++S +G Sbjct: 364 GHDLTLIATDGEPVHPVRVNTIISFSG 390 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,627 Number of Sequences: 336 Number of extensions: 3450 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -