BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_J02 (878 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117193-4|CAB54984.1| 335|Caenorhabditis elegans Hypothetical ... 29 5.8 AL117193-3|CAB54983.1| 335|Caenorhabditis elegans Hypothetical ... 29 5.8 AL117193-5|CAB54985.1| 335|Caenorhabditis elegans Hypothetical ... 28 7.7 AL117193-2|CAB54982.1| 335|Caenorhabditis elegans Hypothetical ... 28 7.7 >AL117193-4|CAB54984.1| 335|Caenorhabditis elegans Hypothetical protein Y105C5A.5 protein. Length = 335 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 127 CACSPPARASLNXPRTLLTKPSRXNCTTASSPAXTTVLS 243 C C+P + S + RT T+P + +C+ ++ T S Sbjct: 29 CGCAPKVQPSCSCQRTTYTQPQQYSCSCQNTAPVQTSCS 67 >AL117193-3|CAB54983.1| 335|Caenorhabditis elegans Hypothetical protein Y105C5A.4 protein. Length = 335 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 127 CACSPPARASLNXPRTLLTKPSRXNCTTASSPAXTTVLS 243 C C+P + S + RT T+P + +C+ ++ T S Sbjct: 29 CGCAPKVQPSCSCQRTTYTQPQQYSCSCQNTAPVQTSCS 67 >AL117193-5|CAB54985.1| 335|Caenorhabditis elegans Hypothetical protein Y105C5A.6 protein. Length = 335 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 127 CACSPPARASLNXPRTLLTKPSRXNCTTASSPAXTTVLS 243 C C+P + S + RT T+P + +C+ ++ T S Sbjct: 29 CGCAPKIQPSCSCQRTTYTQPQQYSCSCQNTAPVQTSCS 67 >AL117193-2|CAB54982.1| 335|Caenorhabditis elegans Hypothetical protein Y105C5A.3 protein. Length = 335 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 127 CACSPPARASLNXPRTLLTKPSRXNCTTASSPAXTTVLS 243 C C+P + S + RT T+P + +C+ ++ T S Sbjct: 29 CGCAPKIQPSCSCQRTTYTQPQQYSCSCQNTAPVQTSCS 67 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,764,448 Number of Sequences: 27780 Number of extensions: 262906 Number of successful extensions: 778 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2213393798 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -